Endometriosis Knowledgebase

Search Result

Gene id

3066

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HDAC2 Gene UCSC Ensembl

Aliases

HD2, RPD3, YAF1

Gene name

histone deacetylase 2

Alternate names

histone deacetylase 2, YY1-associated factor 1, transcriptional regulator homolog RPD3,

Gene location

6q21 (113971194: 113936155) Exons: 17 NC_000006.12

Gene summary(Entrez)

This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2010]

OMIM

605164

Protein Summary

Protein general information

Q92769

Name: Histone deacetylase 2 (HD2) (EC 3.5.1.98)

Length: 488 Mass: 55,364

Tissue specificity: Widely expressed; lower levels in brain and lung.

Sequence

MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIK
FLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASG
FCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAV
NFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLP
HAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEED
KKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP

Structural information

Interpro:	IPR000286 IPR003084 IPR023801
Pfam:	PF00850
PDB:	3MAX 4LXZ 4LY1 5IWG 5IX0
PDBsum:	3MAX 4LXZ 4LY1 5IWG 5IX0
DIP:	24220
MINT:	90593
STRING:	ENSP00000430432;

Other Databases

GeneCards: HDAC2; Malacards: HDAC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0001047	core promoter binding	IEA	molecular_function
GO:0001103	RNA polymerase II repress ing transcription factor binding	IPI	molecular_function
GO:0001975	response to amphetamine	IEA	biological_process
GO:0003300	cardiac muscle hypertroph y	IEA	biological_process
GO:0003682	chromatin binding	ISS	molecular_function
GO:0004407	histone deacetylase activ ity	IDA	molecular_function
GO:0004407	histone deacetylase activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006338	chromatin remodeling	IC	biological_process
GO:0006344	maintenance of chromatin silencing	IMP	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009913	epidermal cell differenti ation	ISS	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IEA	biological_process
GO:0010870	positive regulation of re ceptor biosynthetic proce ss	IMP	biological_process
GO:0010977	negative regulation of ne uron projection developme nt	ISS	biological_process
GO:0016358	dendrite development	ISS	biological_process
GO:0016575	histone deacetylation	IMP	biological_process
GO:0016580	Sin3 complex	IDA	cellular_component
GO:0016580	Sin3 complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0019213	deacetylase activity	ISS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0031000	response to caffeine	IEA	biological_process
GO:0031072	heat shock protein bindin g	IEA	molecular_function
GO:0032041	NAD-dependent histone dea cetylase activity (H3-K14 specific)	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032732	positive regulation of in terleukin-1 production	IEA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IC	biological_process
GO:0033558	protein deacetylase activ ity	IMP	molecular_function
GO:0034605	cellular response to heat	IEA	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035098	ESC/E(Z) complex	IDA	cellular_component
GO:0042220	response to cocaine	IEA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	ISS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0042733	embryonic digit morphogen esis	ISS	biological_process
GO:0043044	ATP-dependent chromatin r emodeling	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043392	negative regulation of DN A binding	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045347	negative regulation of MH C class II biosynthetic p rocess	IC	biological_process
GO:0045862	positive regulation of pr oteolysis	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IC	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IC	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0048149	behavioral response to et hanol	IEA	biological_process
GO:0048714	positive regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0055093	response to hyperoxia	IEA	biological_process
GO:0060789	hair follicle placode for mation	ISS	biological_process
GO:0061000	negative regulation of de ndritic spine development	IEA	biological_process
GO:0061029	eyelid development in cam era-type eye	ISS	biological_process
GO:0061198	fungiform papilla formati on	ISS	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IEA	biological_process
GO:0070932	histone H3 deacetylation	ISS	biological_process
GO:0070933	histone H4 deacetylation	ISS	biological_process
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1903351	cellular response to dopa mine	IEA	biological_process
GO:2000757	negative regulation of pe ptidyl-lysine acetylation	IEA	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0031492	nucleosomal DNA binding	IDA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000785	chromatin	IEA	cellular_component
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0001047	core promoter binding	IEA	molecular_function
GO:0001103	RNA polymerase II repress ing transcription factor binding	IPI	molecular_function
GO:0001975	response to amphetamine	IEA	biological_process
GO:0003300	cardiac muscle hypertroph y	IEA	biological_process
GO:0003682	chromatin binding	ISS	molecular_function
GO:0004407	histone deacetylase activ ity	IEA	molecular_function
GO:0004407	histone deacetylase activ ity	IEA	molecular_function
GO:0004407	histone deacetylase activ ity	IEA	molecular_function
GO:0004407	histone deacetylase activ ity	IDA	molecular_function
GO:0004407	histone deacetylase activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006338	chromatin remodeling	IC	biological_process
GO:0006344	maintenance of chromatin silencing	IMP	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008134	transcription factor bind ing	IEA	molecular_function
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009913	epidermal cell differenti ation	ISS	biological_process
GO:0010718	positive regulation of ep ithelial to mesenchymal t ransition	IEA	biological_process
GO:0010870	positive regulation of re ceptor biosynthetic proce ss	IMP	biological_process
GO:0010977	negative regulation of ne uron projection developme nt	IEA	biological_process
GO:0010977	negative regulation of ne uron projection developme nt	ISS	biological_process
GO:0016358	dendrite development	ISS	biological_process
GO:0016575	histone deacetylation	IEA	biological_process
GO:0016575	histone deacetylation	IEA	biological_process
GO:0016575	histone deacetylation	IMP	biological_process
GO:0016580	Sin3 complex	IDA	cellular_component
GO:0016580	Sin3 complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0019213	deacetylase activity	ISS	molecular_function
GO:0019899	enzyme binding	IEA	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0031000	response to caffeine	IEA	biological_process
GO:0031072	heat shock protein bindin g	IEA	molecular_function
GO:0032041	NAD-dependent histone dea cetylase activity (H3-K14 specific)	IEA	molecular_function
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032732	positive regulation of in terleukin-1 production	IEA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IC	biological_process
GO:0033558	protein deacetylase activ ity	IMP	molecular_function
GO:0034605	cellular response to heat	IEA	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035098	ESC/E(Z) complex	IDA	cellular_component
GO:0042220	response to cocaine	IEA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	ISS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0042733	embryonic digit morphogen esis	ISS	biological_process
GO:0043044	ATP-dependent chromatin r emodeling	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043392	negative regulation of DN A binding	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045347	negative regulation of MH C class II biosynthetic p rocess	IC	biological_process
GO:0045862	positive regulation of pr oteolysis	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IC	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IC	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0048149	behavioral response to et hanol	IEA	biological_process
GO:0048511	rhythmic process	IEA	biological_process
GO:0048714	positive regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0055093	response to hyperoxia	IEA	biological_process
GO:0060789	hair follicle placode for mation	ISS	biological_process
GO:0061000	negative regulation of de ndritic spine development	IEA	biological_process
GO:0061029	eyelid development in cam era-type eye	ISS	biological_process
GO:0061198	fungiform papilla formati on	ISS	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IEA	biological_process
GO:0070932	histone H3 deacetylation	IEA	biological_process
GO:0070932	histone H3 deacetylation	ISS	biological_process
GO:0070933	histone H4 deacetylation	ISS	biological_process
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0071560	cellular response to tran sforming growth factor be ta stimulus	IEA	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:1903351	cellular response to dopa mine	IEA	biological_process
GO:2000757	negative regulation of pe ptidyl-lysine acetylation	IEA	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0031492	nucleosomal DNA binding	IDA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000790	nuclear chromatin	IDA	cellular_component
GO:0001103	RNA polymerase II repress ing transcription factor binding	IPI	molecular_function
GO:0003682	chromatin binding	ISS	molecular_function
GO:0004407	histone deacetylase activ ity	IDA	molecular_function
GO:0004407	histone deacetylase activ ity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006338	chromatin remodeling	IC	biological_process
GO:0006344	maintenance of chromatin silencing	IMP	biological_process
GO:0007596	blood coagulation	TAS	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0009913	epidermal cell differenti ation	ISS	biological_process
GO:0010870	positive regulation of re ceptor biosynthetic proce ss	IMP	biological_process
GO:0010977	negative regulation of ne uron projection developme nt	ISS	biological_process
GO:0016358	dendrite development	ISS	biological_process
GO:0016575	histone deacetylation	IMP	biological_process
GO:0016580	Sin3 complex	IDA	cellular_component
GO:0016580	Sin3 complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0016581	NuRD complex	IDA	cellular_component
GO:0019213	deacetylase activity	ISS	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019899	enzyme binding	IPI	molecular_function
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0032967	positive regulation of co llagen biosynthetic proce ss	IC	biological_process
GO:0033558	protein deacetylase activ ity	IMP	molecular_function
GO:0035098	ESC/E(Z) complex	IDA	cellular_component
GO:0042475	odontogenesis of dentin-c ontaining tooth	ISS	biological_process
GO:0042733	embryonic digit morphogen esis	ISS	biological_process
GO:0043044	ATP-dependent chromatin r emodeling	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	ISS	biological_process
GO:0043234	protein complex	IDA	cellular_component
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IMP	biological_process
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045347	negative regulation of MH C class II biosynthetic p rocess	IC	biological_process
GO:0045862	positive regulation of pr oteolysis	IMP	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IC	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IC	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0051059	NF-kappaB binding	IPI	molecular_function
GO:0060789	hair follicle placode for mation	ISS	biological_process
GO:0061029	eyelid development in cam era-type eye	ISS	biological_process
GO:0061198	fungiform papilla formati on	ISS	biological_process
GO:0070932	histone H3 deacetylation	ISS	biological_process
GO:0070933	histone H4 deacetylation	ISS	biological_process
GO:1901796	regulation of signal tran sduction by p53 class med iator	TAS	biological_process
GO:0000978	RNA polymerase II core pr omoter proximal region se quence-specific DNA bindi ng	IDA	molecular_function
GO:0000980	RNA polymerase II distal enhancer sequence-specifi c DNA binding	IDA	molecular_function
GO:0031492	nucleosomal DNA binding	IDA	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa05169  Epstein-Barr virus infection
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa04919  Thyroid hormone signaling pathway
hsa05016  Huntington's disease
hsa04110  Cell cycle
hsa05220  Chronic myeloid leukemia
hsa05034  Alcoholism
hsa04213  Longevity regulating pathway
hsa04330  Notch signaling pathway

Diseases

Associated diseases	References
Cancer	PMID: 19064572
Endometriosis	PMID: 22344732
Endometriosis	INFBASE23080547

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23080547	Endometrio sis			15 patients wit h endometriosis		SIRT1 HDAC1 SUV39H1 SUV39H2 HDAC2 G9a	Show abstract
22344732	Endometrio sis					HDAC1 HDAC2	Show abstract