Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 307
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol ANXA4   Gene   UCSC   Ensembl
Aliases ANX4, HEL-S-274, P32.5, PAP-II, PIG28, PP4-X, ZAP36
Gene name annexin A4
Alternate names annexin A4, 35-beta calcimedin, annexin IV (placental anticoagulant protein II), annexin-4, carbohydrate-binding protein p33/p41, chromobindin-4, endonexin I, epididymis secretory protein Li 274, lipocortin IV, placental anticoagulant protein II,
Gene location 2p13.3 (69643804: 69826476)     Exons: 18     NC_000002.12
Gene summary(Entrez) Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2016]
OMIM 106491

Protein Summary

Protein general information P09525  

Name: Annexin A4 (35 beta calcimedin) (Annexin IV) (Annexin 4) (Carbohydrate binding protein p33/p41) (Chromobindin 4) (Endonexin I) (Lipocortin IV) (P32.5) (PP4 X) (Placental anticoagulant protein II) (PAP II) (Protein II)

Length: 319  Mass: 35,883

Sequence MATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGN
FEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQR
VLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIK
SETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIK
GDTSGDYRKVLLVLCGGDD
Structural information
Interpro:  IPR001464 IPR018502 IPR018252 IPR002391
Prosite:   PS00223

Pfam:  
PF00191

PDB:  
2ZOC
PDBsum:   2ZOC
MINT:   4528752
STRING:   ENSP00000377833;
Other Databases GeneCards:  ANXA4;  Malacards:  ANXA4

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0004859 phospholipase inhibitor a
ctivity
NAS molecular_function
GO:0005509 calcium ion binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005544 calcium-dependent phospho
lipid binding
IDA molecular_function
GO:0005544 calcium-dependent phospho
lipid binding
NAS molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
IDA biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007219 Notch signaling pathway
IEA biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0012506 vesicle membrane
IDA cellular_component
GO:0030855 epithelial cell different
iation
IEP biological_process
GO:0031965 nuclear membrane
IDA cellular_component
GO:0032088 negative regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0042802 identical protein binding
IPI molecular_function
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0043086 negative regulation of ca
talytic activity
IEA biological_process
GO:0048306 calcium-dependent protein
binding
IPI molecular_function
GO:0048306 calcium-dependent protein
binding
IPI molecular_function
GO:0048471 perinuclear region of cyt
oplasm
IDA cellular_component
GO:0051059 NF-kappaB binding
IPI molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:2000483 negative regulation of in
terleukin-8 secretion
IMP biological_process
GO:0004859 phospholipase inhibitor a
ctivity
NAS molecular_function
GO:0005509 calcium ion binding
IEA molecular_function
GO:0005509 calcium ion binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005544 calcium-dependent phospho
lipid binding
IEA molecular_function
GO:0005544 calcium-dependent phospho
lipid binding
IEA molecular_function
GO:0005544 calcium-dependent phospho
lipid binding
IDA molecular_function
GO:0005544 calcium-dependent phospho
lipid binding
NAS molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
IDA biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0007219 Notch signaling pathway
IEA biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0012506 vesicle membrane
IDA cellular_component
GO:0030855 epithelial cell different
iation
IEP biological_process
GO:0031965 nuclear membrane
IDA cellular_component
GO:0032088 negative regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0042802 identical protein binding
IPI molecular_function
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0043086 negative regulation of ca
talytic activity
IEA biological_process
GO:0048306 calcium-dependent protein
binding
IPI molecular_function
GO:0048306 calcium-dependent protein
binding
IPI molecular_function
GO:0048471 perinuclear region of cyt
oplasm
IDA cellular_component
GO:0051059 NF-kappaB binding
IPI molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:2000483 negative regulation of in
terleukin-8 secretion
IMP biological_process
GO:0004859 phospholipase inhibitor a
ctivity
NAS molecular_function
GO:0005509 calcium ion binding
IDA molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005544 calcium-dependent phospho
lipid binding
IDA molecular_function
GO:0005544 calcium-dependent phospho
lipid binding
NAS molecular_function
GO:0005634 nucleus
IDA cellular_component
GO:0005634 nucleus
IDA cellular_component
GO:0005737 cytoplasm
TAS cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0006357 regulation of transcripti
on from RNA polymerase II
promoter
IDA biological_process
GO:0007165 signal transduction
TAS biological_process
GO:0009986 cell surface
IDA cellular_component
GO:0012506 vesicle membrane
IDA cellular_component
GO:0030855 epithelial cell different
iation
IEP biological_process
GO:0031965 nuclear membrane
IDA cellular_component
GO:0032088 negative regulation of NF
-kappaB transcription fac
tor activity
IDA biological_process
GO:0042802 identical protein binding
IPI molecular_function
GO:0043066 negative regulation of ap
optotic process
TAS biological_process
GO:0048306 calcium-dependent protein
binding
IPI molecular_function
GO:0048306 calcium-dependent protein
binding
IPI molecular_function
GO:0048471 perinuclear region of cyt
oplasm
IDA cellular_component
GO:0051059 NF-kappaB binding
IPI molecular_function
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:0070062 extracellular exosome
IDA cellular_component
GO:2000483 negative regulation of in
terleukin-8 secretion
IMP biological_process

Diseases

Associated diseases References
Asthenozoospermia PMID: 20369545
Endometriosis PMID: 22883517
Female infertility PMID: 22999554
Endometriosis associated infertility INFBASE22883517
Endometriosis INFBASE22883517

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
22883517 Endometrio
sis

20 (10 infertil
e cases with en
dometriosis as
endometriosis g
roup, 10 infert
ile cases with
tubal factors a
s control group
)
Female infertility Annexin A4
Show abstract