Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 3082
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary
Gene Symbol HGF   Gene   UCSC   Ensembl
Aliases DFNB39, F-TCF, HGFB, HPTA, SF
Gene name hepatocyte growth factor
Alternate names hepatocyte growth factor, fibroblast-derived tumor cytotoxic factor, hepatocyte growth factor (hepapoietin A; scatter factor), hepatopoietin-A, lung fibroblast-derived mitogen,
Gene location 7q21.11 (135895826: 135892245)     Exons: 5     NC_000005.10
Gene summary(Entrez) This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate alpha and beta chains, which form the mature heterodimer. This protein is secreted by mesenchymal cells and acts as a multi-functional cytokine on cells of mainly epithelial origin. This protein also plays a role in angiogenesis, tumorogenesis, and tissue regeneration. Although the encoded protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Mutations in this gene are associated with nonsyndromic hearing loss. [provided by RefSeq, Nov 2015]
OMIM 142409

Protein Summary
Protein general information P14210  

Name: Hepatocyte growth factor (Hepatopoietin-A) (Scatter factor) (SF) [Cleaved into: Hepatocyte growth factor alpha chain; Hepatocyte growth factor beta chain]

Length: 728  Mass: 83,134

Sequence MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCT
RNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQ
PWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDH
TESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPL
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRENYCRNPDGSESPWCFTTDPNIRVG
YCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNENYCRNPDDDAHGP
WCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMVSLRYRNKHICGGSLIK
ESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGG
PLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Structural information
Protein Domains
 PAN. (37-123)
Kringle (128-206)
Kringle (211-288)
Kringle (305-383)
Kringle (391-469)
Peptidase (495-721)
Interpro:  IPR027284 IPR024174 IPR000001 IPR013806 IPR018056 IPR038178 IPR003609 IPR009003 IPR001314 IPR001254
Prosite:   PS00021 PS50070 PS50948 PS50240

Pfam:  		 PF00051 PF00024 PF00089
CDD:   cd00190

PDB:  		 1BHT 1GMN 1GMO 1GP9 1NK1 1SHY 1SI5 2HGF 2QJ2 3HMS 3HMT 3HN4 3MKP 3SP8 4D3C 4K3J 4O3T 4O3U 5COE 5CP9 5CS1 5CS3 5CS5 5CS9 5CSQ 5CT1 5CT2 5CT3
PDBsum:   1BHT 1GMN 1GMO 1GP9 1NK1 1SHY 1SI5 2HGF 2QJ2 3HMS 3HMT 3HN4 3MKP 3SP8 4D3C 4K3J 4O3T 4O3U 5COE 5CP9 5CS1 5CS3 5CS5 5CS9 5CSQ 5CT1 5CT2 5CT3

DIP:  		 37535
MINT:  
STRING:   ENSP00000222390;
Other Databases GeneCards:  HGF;  Malacards:  HGF

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000187 activation of MAPK activi
ty
 IEA biological_process
GO:0001837 epithelial to mesenchymal
transition
 TAS biological_process
GO:0001889 liver development
 IEA biological_process
GO:0002576 platelet degranulation
 TAS biological_process
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005576 extracellular region
 TAS cellular_component
GO:0005615 extracellular space
 IBA cellular_component
GO:0007067 mitotic nuclear division
 NAS biological_process
GO:0008083 growth factor activity
 NAS molecular_function
GO:0008284 positive regulation of ce
ll proliferation
 IBA biological_process
GO:0010507 negative regulation of au
tophagy
 NAS biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
 IDA biological_process
GO:0016020 membrane
 IDA cellular_component
GO:0030212 hyaluronan metabolic proc
ess
 IEA biological_process
GO:0030335 positive regulation of ce
ll migration
 IDA biological_process
GO:0031093 platelet alpha granule lu
men
 TAS cellular_component
GO:0031100 animal organ regeneration
 IEA biological_process
GO:0031643 positive regulation of my
elination
 IEA biological_process
GO:0032715 negative regulation of in
terleukin-6 production
 IEA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
 IEA biological_process
GO:0033137 negative regulation of pe
ptidyl-serine phosphoryla
tion
 IEA biological_process
GO:0035729 cellular response to hepa
tocyte growth factor stim
ulus
 IDA biological_process
GO:0042056 chemoattractant activity
 IDA molecular_function
GO:0042802 identical protein binding
 IPI molecular_function
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IDA biological_process
GO:0045669 positive regulation of os
teoblast differentiation
 NAS biological_process
GO:0045766 positive regulation of an
giogenesis
 IEA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 NAS biological_process
GO:0046982 protein heterodimerizatio
n activity
 IEA molecular_function
GO:0048012 hepatocyte growth factor
receptor signaling pathwa
y
 IDA biological_process
GO:0050728 negative regulation of in
flammatory response
 IEA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
 IDA biological_process
GO:0050918 positive chemotaxis
 IEA biological_process
GO:0051450 myoblast proliferation
 IEA biological_process
GO:0060326 cell chemotaxis
 IDA biological_process
GO:0060665 regulation of branching i
nvolved in salivary gland
morphogenesis by mesench
ymal-epithelial signaling
 IDA biological_process
GO:0070572 positive regulation of ne
uron projection regenerat
ion
 IEA biological_process
GO:0090201 negative regulation of re
lease of cytochrome c fro
m mitochondria
 IDA biological_process
GO:1900744 regulation of p38MAPK cas
cade
 IEA biological_process
GO:1901299 negative regulation of hy
drogen peroxide-mediated
programmed cell death
 IDA biological_process
GO:1902042 negative regulation of ex
trinsic apoptotic signali
ng pathway via death doma
in receptors
 IEA biological_process
GO:1902947 regulation of tau-protein
kinase activity
 IEA biological_process
GO:2000573 positive regulation of DN
A biosynthetic process
 IDA biological_process
GO:0004252 serine-type endopeptidase
activity
 NAS molecular_function
GO:0006508 proteolysis
 NAS biological_process
GO:0000187 activation of MAPK activi
ty
 IEA biological_process
GO:0000902 cell morphogenesis
 IEA biological_process
GO:0001837 epithelial to mesenchymal
transition
 TAS biological_process
GO:0001889 liver development
 IEA biological_process
GO:0002576 platelet degranulation
 TAS biological_process
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005576 extracellular region
 TAS cellular_component
GO:0005615 extracellular space
 IEA cellular_component
GO:0005615 extracellular space
 IBA cellular_component
GO:0007067 mitotic nuclear division
 NAS biological_process
GO:0008083 growth factor activity
 IEA molecular_function
GO:0008083 growth factor activity
 IEA molecular_function
GO:0008083 growth factor activity
 NAS molecular_function
GO:0008283 cell proliferation
 IEA biological_process
GO:0008284 positive regulation of ce
ll proliferation
 IBA biological_process
GO:0010507 negative regulation of au
tophagy
 NAS biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
 IDA biological_process
GO:0016020 membrane
 IDA cellular_component
GO:0030212 hyaluronan metabolic proc
ess
 IEA biological_process
GO:0030335 positive regulation of ce
ll migration
 IDA biological_process
GO:0031093 platelet alpha granule lu
men
 TAS cellular_component
GO:0031100 animal organ regeneration
 IEA biological_process
GO:0031643 positive regulation of my
elination
 IEA biological_process
GO:0032715 negative regulation of in
terleukin-6 production
 IEA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
 IEA biological_process
GO:0033137 negative regulation of pe
ptidyl-serine phosphoryla
tion
 IEA biological_process
GO:0035729 cellular response to hepa
tocyte growth factor stim
ulus
 IDA biological_process
GO:0042056 chemoattractant activity
 IDA molecular_function
GO:0042802 identical protein binding
 IPI molecular_function
GO:0043066 negative regulation of ap
optotic process
 IEA biological_process
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IDA biological_process
GO:0045669 positive regulation of os
teoblast differentiation
 NAS biological_process
GO:0045766 positive regulation of an
giogenesis
 IEA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 NAS biological_process
GO:0046982 protein heterodimerizatio
n activity
 IEA molecular_function
GO:0048012 hepatocyte growth factor
receptor signaling pathwa
y
 IEA biological_process
GO:0048012 hepatocyte growth factor
receptor signaling pathwa
y
 IDA biological_process
GO:0050728 negative regulation of in
flammatory response
 IEA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
 IDA biological_process
GO:0050918 positive chemotaxis
 IEA biological_process
GO:0051450 myoblast proliferation
 IEA biological_process
GO:0060326 cell chemotaxis
 IDA biological_process
GO:0060665 regulation of branching i
nvolved in salivary gland
morphogenesis by mesench
ymal-epithelial signaling
 IEA biological_process
GO:0060665 regulation of branching i
nvolved in salivary gland
morphogenesis by mesench
ymal-epithelial signaling
 IDA biological_process
GO:0070572 positive regulation of ne
uron projection regenerat
ion
 IEA biological_process
GO:0090201 negative regulation of re
lease of cytochrome c fro
m mitochondria
 IDA biological_process
GO:1900744 regulation of p38MAPK cas
cade
 IEA biological_process
GO:1901299 negative regulation of hy
drogen peroxide-mediated
programmed cell death
 IDA biological_process
GO:1902042 negative regulation of ex
trinsic apoptotic signali
ng pathway via death doma
in receptors
 IEA biological_process
GO:1902947 regulation of tau-protein
kinase activity
 IEA biological_process
GO:2000573 positive regulation of DN
A biosynthetic process
 IDA biological_process
GO:0004252 serine-type endopeptidase
activity
 NAS molecular_function
GO:0006508 proteolysis
 NAS biological_process
GO:0001837 epithelial to mesenchymal
transition
 TAS biological_process
GO:0002576 platelet degranulation
 TAS biological_process
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005515 protein binding
 IPI molecular_function
GO:0005576 extracellular region
 TAS cellular_component
GO:0005615 extracellular space
 IBA cellular_component
GO:0007067 mitotic nuclear division
 NAS biological_process
GO:0008083 growth factor activity
 NAS molecular_function
GO:0008284 positive regulation of ce
ll proliferation
 IBA biological_process
GO:0010507 negative regulation of au
tophagy
 NAS biological_process
GO:0014068 positive regulation of ph
osphatidylinositol 3-kina
se signaling
 IDA biological_process
GO:0016020 membrane
 IDA cellular_component
GO:0030335 positive regulation of ce
ll migration
 IDA biological_process
GO:0031093 platelet alpha granule lu
men
 TAS cellular_component
GO:0035729 cellular response to hepa
tocyte growth factor stim
ulus
 IDA biological_process
GO:0042056 chemoattractant activity
 IDA molecular_function
GO:0042802 identical protein binding
 IPI molecular_function
GO:0043154 negative regulation of cy
steine-type endopeptidase
activity involved in apo
ptotic process
 IDA biological_process
GO:0045669 positive regulation of os
teoblast differentiation
 NAS biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
 NAS biological_process
GO:0048012 hepatocyte growth factor
receptor signaling pathwa
y
 IDA biological_process
GO:0050731 positive regulation of pe
ptidyl-tyrosine phosphory
lation
 IDA biological_process
GO:0060326 cell chemotaxis
 IDA biological_process
GO:0060665 regulation of branching i
nvolved in salivary gland
morphogenesis by mesench
ymal-epithelial signaling
 IDA biological_process
GO:0090201 negative regulation of re
lease of cytochrome c fro
m mitochondria
 IDA biological_process
GO:1901299 negative regulation of hy
drogen peroxide-mediated
programmed cell death
 IDA biological_process
GO:2000573 positive regulation of DN
A biosynthetic process
 IDA biological_process
GO:0004252 serine-type endopeptidase
activity
 NAS molecular_function
GO:0006508 proteolysis
 NAS biological_process

Diseases

Associated diseases References
Amyotrophic lateral sclerosis (ALS) PMID: 18608101
Endometriosis PMID: 28433374
Breast cancer PMID: 19188684
Carotid artery stenosis PMID: 20066125
Chronic renal failure PMID: 21085059
Diabetes PMID: 12732844
Endometriosis PMID: 28433374
Hyperparathyroidism PMID: 20424473
Hypertension PMID: 15127882
Myopia PMID: 19060265
Myopia PMID: 19471602
Endometriosis INFBASE28433374
Prostate cancer PMID: 15042617
Vitiligo PMID: 19416273

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
28433374 Endometrio
sis
107 female infe
rtility (56 end
ometriosis pati
ents, 38 patien
ts without endo
metriosis)
 Female infertility
Show abstract