Endometriosis Knowledgebase

Search Result

Gene id

3091

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HIF1A Gene UCSC Ensembl

Aliases

HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78

Gene name

hypoxia inducible factor 1 alpha subunit

Alternate names

hypoxia-inducible factor 1-alpha, ARNT interacting protein, PAS domain-containing protein 8, basic-helix-loop-helix-PAS protein MOP1, class E basic helix-loop-helix protein 78, hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription fac,

Gene location

14q23.2 (61695400: 61748258) Exons: 16 NC_000014.9

Gene summary(Entrez)

This gene encodes the alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in energy metabolism, angiogenesis, apoptosis, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in embryonic vascularization, tumor angiogenesis and pathophysiology of ischemic disease. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2011]

OMIM

603348

SNPs

rs11549465

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000676.2   g.61740839C>T
NC_000014.8   g.62207557C>T
NC_000014.9   g.61740839C>T
NG_029606.1   g.50439C>T
NM_001243084.1   c.1816C>T
NM_001530.3   c.1744C>T
NM_181054.2   c.1744C>T
NP_001230013.1   p.Pro606Ser
NP_001521.1   p.Pro582Ser
NP_851397.1   p.Pro582Ser
NR_144368.1   n.213+10046G>A
XP_005267630.1   p.Pro583Ser
XP_005267631.1   p.Pro583Ser
XR_001750789.1   n.213+10046G>A

Protein Summary

Protein general information

Q16665

Name: Hypoxia inducible factor 1 alpha (HIF 1 alpha) (HIF1 alpha) (ARNT interacting protein) (Basic helix loop helix PAS protein MOP1) (Class E basic helix loop helix protein 78) (bHLHe78) (Member of PAS protein 1) (PAS domain containing protein 8)

Length: 826 Mass: 92,670

Tissue specificity: Expressed in most tissues with highest levels in kidney and heart. Overexpressed in the majority of common human cancers and their metastases, due to the presence of intratumoral hypoxia and as a result of mutations in genes encoding o

Sequence

MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDA
GDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTH
RNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICE
PIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLF
TKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAM
SPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDS
DMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKG
VIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSL
SWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQV
N

Structural information

Protein Domains	bHLH. (17-70) PAS (85-158) PAS (228-298) PAC. (302-345)
Motifs	Nuclear localization(718-721)
Interpro:	IPR011598 IPR001321 IPR014887 IPR021537 IPR001610 IPR000014 IPR013767 IPR013655
Prosite:	PS50888 PS50112
Pfam:	PF11413 PF08778 PF00989 PF08447
CDD:	cd00083 cd00130
PDB:	1D7G 1H2K 1H2L 1H2M 1L3E 1L8C 1LM8 1LQB 2ILM 3HQR 3HQU 4AJY 4H6J 5JWP 5L9B 5L9V 5LA9 5LAS
PDBsum:	1D7G 1H2K 1H2L 1H2M 1L3E 1L8C 1LM8 1LQB 2ILM 3HQR 3HQU 4AJY 4H6J 5JWP 5L9B 5L9V 5LA9 5LAS
DIP:	29722
MINT:	133270
STRING:	ENSP00000338018;

Other Databases

GeneCards: HIF1A; Malacards: HIF1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000989	transcription factor acti vity, transcription facto r binding	IDA	molecular_function
GO:0001076	transcription factor acti vity, RNA polymerase II t ranscription factor bindi ng	IEA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IMP	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IMP	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001755	neural crest cell migrati on	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	ISS	biological_process
GO:0001892	embryonic placenta develo pment	IEA	biological_process
GO:0001922	B-1 B cell homeostasis	IEA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IC	biological_process
GO:0001947	heart looping	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	IEA	biological_process
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	ISS	biological_process
GO:0003151	outflow tract morphogenes is	IEA	biological_process
GO:0003208	cardiac ventricle morphog enesis	IEA	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IPI	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006089	lactate metabolic process	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IMP	biological_process
GO:0006879	cellular iron ion homeost asis	IEA	biological_process
GO:0006953	acute-phase response	IEA	biological_process
GO:0007165	signal transduction	IMP	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008542	visual learning	IEA	biological_process
GO:0009651	response to salt stress	IEA	biological_process
GO:0010165	response to X-ray	IEA	biological_process
GO:0010468	regulation of gene expres sion	IDA	biological_process
GO:0010573	vascular endothelial grow th factor production	IDA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	ISS	biological_process
GO:0010870	positive regulation of re ceptor biosynthetic proce ss	IMP	biological_process
GO:0010996	response to auditory stim ulus	IEA	biological_process
GO:0014074	response to purine-contai ning compound	IEA	biological_process
GO:0014850	response to muscle activi ty	IEA	biological_process
GO:0016607	nuclear speck	ISS	cellular_component
GO:0019896	axonal transport of mitoc hondrion	IMP	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0021502	neural fold elevation for mation	IEA	biological_process
GO:0021987	cerebral cortex developme nt	IEA	biological_process
GO:0030502	negative regulation of bo ne mineralization	IEA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IC	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IC	biological_process
GO:0031514	motile cilium	IEA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032007	negative regulation of TO R signaling	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032364	oxygen homeostasis	IDA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0032722	positive regulation of ch emokine production	TAS	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032909	regulation of transformin g growth factor beta2 pro duction	IMP	biological_process
GO:0032963	collagen metabolic proces s	ISS	biological_process
GO:0035035	histone acetyltransferase binding	IPI	molecular_function
GO:0035162	embryonic hemopoiesis	IEA	biological_process
GO:0035257	nuclear hormone receptor binding	IPI	molecular_function
GO:0035690	cellular response to drug	IEA	biological_process
GO:0035774	positive regulation of in sulin secretion involved in cellular response to g lucose stimulus	IEA	biological_process
GO:0042541	hemoglobin biosynthetic p rocess	IEA	biological_process
GO:0042789	mRNA transcription from R NA polymerase II promoter	IC	biological_process
GO:0042826	histone deacetylase bindi ng	IEA	molecular_function
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043279	response to alkaloid	IEA	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	IDA	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	IDA	biological_process
GO:0045648	positive regulation of er ythrocyte differentiation	IC	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IC	biological_process
GO:0045793	positive regulation of ce ll size	IEA	biological_process
GO:0045821	positive regulation of gl ycolytic process	IC	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045906	negative regulation of va soconstriction	IEA	biological_process
GO:0045926	negative regulation of gr owth	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0046716	muscle cell cellular home ostasis	IEA	biological_process
GO:0046886	positive regulation of ho rmone biosynthetic proces s	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046982	protein heterodimerizatio n activity	TAS	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048546	digestive tract morphogen esis	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	TAS	biological_process
GO:0051216	cartilage development	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051541	elastin metabolic process	ISS	biological_process
GO:0051879	Hsp90 protein binding	IDA	molecular_function
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0060574	intestinal epithelial cel l maturation	IEA	biological_process
GO:0060992	response to fungicide	IEA	biological_process
GO:0061030	epithelial cell different iation involved in mammar y gland alveolus developm ent	IEA	biological_process
GO:0061072	iris morphogenesis	IEA	biological_process
GO:0061298	retina vasculature develo pment in camera-type eye	IEA	biological_process
GO:0061418	regulation of transcripti on from RNA polymerase II promoter in response to hypoxia	TAS	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IMP	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IDA	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IMP	biological_process
GO:0070101	positive regulation of ch emokine-mediated signalin g pathway	IC	biological_process
GO:0070244	negative regulation of th ymocyte apoptotic process	IEA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071245	cellular response to carb on monoxide	IEA	biological_process
GO:0071250	cellular response to nitr ite	IEA	biological_process
GO:0071257	cellular response to elec trical stimulus	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071279	cellular response to coba lt ion	IEA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEP	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0071456	cellular response to hypo xia	IEP	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0071482	cellular response to ligh t stimulus	IEA	biological_process
GO:0071542	dopaminergic neuron diffe rentiation	IEA	biological_process
GO:0072347	response to anesthetic	IEA	biological_process
GO:0090575	RNA polymerase II transcr iption factor complex	IDA	cellular_component
GO:0090575	RNA polymerase II transcr iption factor complex	IDA	cellular_component
GO:0097237	cellular response to toxi c substance	IEA	biological_process
GO:0097411	hypoxia-inducible factor- 1alpha signaling pathway	IEA	biological_process
GO:1900037	regulation of cellular re sponse to hypoxia	IEA	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1903377	negative regulation of ox idative stress-induced ne uron intrinsic apoptotic signaling pathway	IDA	biological_process
GO:1903599	positive regulation of mi tophagy	IEA	biological_process
GO:1903715	regulation of aerobic res piration	IEA	biological_process
GO:1903928	cellular response to cyan ide	IEA	biological_process
GO:1904115	axon cytoplasm	IEA	cellular_component
GO:2000378	negative regulation of re active oxygen species met abolic process	IEA	biological_process
GO:2001054	negative regulation of me senchymal cell apoptotic process	IEA	biological_process
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000981	RNA polymerase II transcr iption factor activity, s equence-specific DNA bind ing	IEA	molecular_function
GO:0000989	transcription factor acti vity, transcription facto r binding	IDA	molecular_function
GO:0001076	transcription factor acti vity, RNA polymerase II t ranscription factor bindi ng	IEA	molecular_function
GO:0001077	transcriptional activator activity, RNA polymerase II core promoter proxima l region sequence-specifi c binding	IEA	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IMP	molecular_function
GO:0001525	angiogenesis	IEA	biological_process
GO:0001568	blood vessel development	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IMP	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001755	neural crest cell migrati on	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	IEA	biological_process
GO:0001837	epithelial to mesenchymal transition	ISS	biological_process
GO:0001892	embryonic placenta develo pment	IEA	biological_process
GO:0001922	B-1 B cell homeostasis	IEA	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IC	biological_process
GO:0001944	vasculature development	IEA	biological_process
GO:0001947	heart looping	IEA	biological_process
GO:0002052	positive regulation of ne uroblast proliferation	IEA	biological_process
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	IEA	biological_process
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	ISS	biological_process
GO:0003151	outflow tract morphogenes is	IEA	biological_process
GO:0003208	cardiac ventricle morphog enesis	IEA	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IEA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IPI	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006089	lactate metabolic process	IEA	biological_process
GO:0006110	regulation of glycolytic process	IEA	biological_process
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IEA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IMP	biological_process
GO:0006879	cellular iron ion homeost asis	IEA	biological_process
GO:0006953	acute-phase response	IEA	biological_process
GO:0007165	signal transduction	IMP	biological_process
GO:0007595	lactation	IEA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009651	response to salt stress	IEA	biological_process
GO:0009749	response to glucose	IEA	biological_process
GO:0010165	response to X-ray	IEA	biological_process
GO:0010468	regulation of gene expres sion	IEA	biological_process
GO:0010468	regulation of gene expres sion	IDA	biological_process
GO:0010508	positive regulation of au tophagy	IEA	biological_process
GO:0010573	vascular endothelial grow th factor production	IDA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	IEA	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	ISS	biological_process
GO:0010870	positive regulation of re ceptor biosynthetic proce ss	IMP	biological_process
GO:0010996	response to auditory stim ulus	IEA	biological_process
GO:0014074	response to purine-contai ning compound	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014850	response to muscle activi ty	IEA	biological_process
GO:0016239	positive regulation of ma croautophagy	IEA	biological_process
GO:0016607	nuclear speck	IEA	cellular_component
GO:0016607	nuclear speck	ISS	cellular_component
GO:0016607	nuclear speck	IEA	cellular_component
GO:0019896	axonal transport of mitoc hondrion	IMP	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0021502	neural fold elevation for mation	IEA	biological_process
GO:0021987	cerebral cortex developme nt	IEA	biological_process
GO:0030154	cell differentiation	IEA	biological_process
GO:0030279	negative regulation of os sification	IEA	biological_process
GO:0030502	negative regulation of bo ne mineralization	IEA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IEA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IC	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IC	biological_process
GO:0031514	motile cilium	IEA	cellular_component
GO:0031625	ubiquitin protein ligase binding	IEA	molecular_function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032007	negative regulation of TO R signaling	IEA	biological_process
GO:0032025	response to cobalt ion	IEA	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032364	oxygen homeostasis	IEA	biological_process
GO:0032364	oxygen homeostasis	IDA	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0032722	positive regulation of ch emokine production	TAS	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0032909	regulation of transformin g growth factor beta2 pro duction	IMP	biological_process
GO:0032963	collagen metabolic proces s	IEA	biological_process
GO:0032963	collagen metabolic proces s	ISS	biological_process
GO:0035035	histone acetyltransferase binding	IPI	molecular_function
GO:0035162	embryonic hemopoiesis	IEA	biological_process
GO:0035257	nuclear hormone receptor binding	IPI	molecular_function
GO:0035690	cellular response to drug	IEA	biological_process
GO:0035774	positive regulation of in sulin secretion involved in cellular response to g lucose stimulus	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042541	hemoglobin biosynthetic p rocess	IEA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042789	mRNA transcription from R NA polymerase II promoter	IC	biological_process
GO:0042826	histone deacetylase bindi ng	IEA	molecular_function
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043279	response to alkaloid	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043565	sequence-specific DNA bin ding	IEA	molecular_function
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	IEA	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	IDA	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	IDA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0045648	positive regulation of er ythrocyte differentiation	IEA	biological_process
GO:0045648	positive regulation of er ythrocyte differentiation	IC	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IC	biological_process
GO:0045793	positive regulation of ce ll size	IEA	biological_process
GO:0045821	positive regulation of gl ycolytic process	IC	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045906	negative regulation of va soconstriction	IEA	biological_process
GO:0045926	negative regulation of gr owth	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0046716	muscle cell cellular home ostasis	IEA	biological_process
GO:0046886	positive regulation of ho rmone biosynthetic proces s	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046982	protein heterodimerizatio n activity	TAS	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046983	protein dimerization acti vity	IEA	molecular_function
GO:0048514	blood vessel morphogenesi s	IEA	biological_process
GO:0048546	digestive tract morphogen esis	IEA	biological_process
GO:0048593	camera-type eye morphogen esis	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0050790	regulation of catalytic a ctivity	IEA	biological_process
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	TAS	biological_process
GO:0051216	cartilage development	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051541	elastin metabolic process	IEA	biological_process
GO:0051541	elastin metabolic process	ISS	biological_process
GO:0051879	Hsp90 protein binding	IDA	molecular_function
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0060574	intestinal epithelial cel l maturation	IEA	biological_process
GO:0060992	response to fungicide	IEA	biological_process
GO:0061030	epithelial cell different iation involved in mammar y gland alveolus developm ent	IEA	biological_process
GO:0061072	iris morphogenesis	IEA	biological_process
GO:0061298	retina vasculature develo pment in camera-type eye	IEA	biological_process
GO:0061418	regulation of transcripti on from RNA polymerase II promoter in response to hypoxia	TAS	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IMP	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IDA	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IMP	biological_process
GO:0070101	positive regulation of ch emokine-mediated signalin g pathway	IC	biological_process
GO:0070243	regulation of thymocyte a poptotic process	IEA	biological_process
GO:0070244	negative regulation of th ymocyte apoptotic process	IEA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071245	cellular response to carb on monoxide	IEA	biological_process
GO:0071250	cellular response to nitr ite	IEA	biological_process
GO:0071257	cellular response to elec trical stimulus	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071279	cellular response to coba lt ion	IEA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEP	biological_process
GO:0071396	cellular response to lipi d	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEA	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0071456	cellular response to hypo xia	IEP	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0071482	cellular response to ligh t stimulus	IEA	biological_process
GO:0071542	dopaminergic neuron diffe rentiation	IEA	biological_process
GO:0072347	response to anesthetic	IEA	biological_process
GO:0090575	RNA polymerase II transcr iption factor complex	IDA	cellular_component
GO:0090575	RNA polymerase II transcr iption factor complex	IDA	cellular_component
GO:0097237	cellular response to toxi c substance	IEA	biological_process
GO:0097411	hypoxia-inducible factor- 1alpha signaling pathway	IEA	biological_process
GO:1900037	regulation of cellular re sponse to hypoxia	IEA	biological_process
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1903377	negative regulation of ox idative stress-induced ne uron intrinsic apoptotic signaling pathway	IDA	biological_process
GO:1903599	positive regulation of mi tophagy	IEA	biological_process
GO:1903715	regulation of aerobic res piration	IEA	biological_process
GO:1903928	cellular response to cyan ide	IEA	biological_process
GO:1904115	axon cytoplasm	IEA	cellular_component
GO:2000378	negative regulation of re active oxygen species met abolic process	IEA	biological_process
GO:2001054	negative regulation of me senchymal cell apoptotic process	IEA	biological_process
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0000989	transcription factor acti vity, transcription facto r binding	IDA	molecular_function
GO:0001228	transcriptional activator activity, RNA polymerase II transcription regulat ory region sequence-speci fic binding	IMP	molecular_function
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IMP	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0001837	epithelial to mesenchymal transition	ISS	biological_process
GO:0001938	positive regulation of en dothelial cell proliferat ion	IC	biological_process
GO:0002248	connective tissue replace ment involved in inflamma tory response wound heali ng	ISS	biological_process
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	TAS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005667	transcription factor comp lex	IPI	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IDA	biological_process
GO:0006366	transcription from RNA po lymerase II promoter	IMP	biological_process
GO:0007165	signal transduction	IMP	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0010468	regulation of gene expres sion	IDA	biological_process
GO:0010573	vascular endothelial grow th factor production	IDA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IMP	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IMP	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	ISS	biological_process
GO:0010870	positive regulation of re ceptor biosynthetic proce ss	IMP	biological_process
GO:0016607	nuclear speck	ISS	cellular_component
GO:0019896	axonal transport of mitoc hondrion	IMP	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IC	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IC	biological_process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular_function
GO:0032364	oxygen homeostasis	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	TAS	biological_process
GO:0032909	regulation of transformin g growth factor beta2 pro duction	IMP	biological_process
GO:0032963	collagen metabolic proces s	ISS	biological_process
GO:0035035	histone acetyltransferase binding	IPI	molecular_function
GO:0035257	nuclear hormone receptor binding	IPI	molecular_function
GO:0042789	mRNA transcription from R NA polymerase II promoter	IC	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	IDA	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	IDA	biological_process
GO:0045648	positive regulation of er ythrocyte differentiation	IC	biological_process
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0045766	positive regulation of an giogenesis	IC	biological_process
GO:0045821	positive regulation of gl ycolytic process	IC	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IGI	biological_process
GO:0046886	positive regulation of ho rmone biosynthetic proces s	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046982	protein heterodimerizatio n activity	TAS	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0051000	positive regulation of ni tric-oxide synthase activ ity	TAS	biological_process
GO:0051541	elastin metabolic process	ISS	biological_process
GO:0051879	Hsp90 protein binding	IDA	molecular_function
GO:0061418	regulation of transcripti on from RNA polymerase II promoter in response to hypoxia	TAS	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IMP	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IDA	biological_process
GO:0061419	positive regulation of tr anscription from RNA poly merase II promoter in res ponse to hypoxia	IMP	biological_process
GO:0070101	positive regulation of ch emokine-mediated signalin g pathway	IC	biological_process
GO:0071347	cellular response to inte rleukin-1	IEP	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0071456	cellular response to hypo xia	IEP	biological_process
GO:0071456	cellular response to hypo xia	IDA	biological_process
GO:0090575	RNA polymerase II transcr iption factor complex	IDA	cellular_component
GO:0090575	RNA polymerase II transcr iption factor complex	IDA	cellular_component
GO:1902895	positive regulation of pr i-miRNA transcription fro m RNA polymerase II promo ter	IMP	biological_process
GO:1903377	negative regulation of ox idative stress-induced ne uron intrinsic apoptotic signaling pathway	IDA	biological_process
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0003705	transcription factor acti vity, RNA polymerase II d istal enhancer sequence-s pecific binding	IDA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function
GO:0043565	sequence-specific DNA bin ding	IDA	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa04659  Th17 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa04066  HIF-1 signaling pathway
hsa05230  Central carbon metabolism in cancer
hsa04140  Autophagy - animal
hsa05211  Renal cell carcinoma
hsa05231  Choline metabolism in cancer
hsa04137  Mitophagy - animal

Diseases

Associated diseases	References
Anoxia	PMID: 18763582
Asthenozoospermia	PMID: 24981555
Diabetes	PMID: 16046581
Endometriosis	PMID: 21613300
Erythrocytosis	PMID: 14521712
Hypoxia	PMID: 17407091
Ischemic heart disease	PMID: 16100168
Osteonecrosis	PMID: 17292638
Preeclampsia	PMID: 18980686
Endometriosis	INFBASE17545054
Retinopathy	PMID: 18787502
Tonsillar cancer	KEGG: H01509
Varicocele	PMID: 25335788

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
21613300	Endometrio sis	20 (10 women wi th endometriosi s, 10 control w omen)	COX-2 CDX1 SHP HIF-1	Show abstract
25750101	Endometrio sis	43 (23 patients with endometri osis (6 for sta ge1, 9 for stag e 2, 5 for stag e 3, 3 fro stag e 4)), 20 contr ols (5 from pro liferative phas e, 7 from early secretory phas e, 4 from mid s ecretory and 4 from late secre tory)	STAT3 HIF1A	Show abstract
17545054	Endometrio sis	108 (20 normal endometrium, 20 ectopic endome trium, 68 eutop ic endometrium specimens from 68 endometriosi s patients)	HIF-1alpha	Show abstract