Endometriosis Knowledgebase

Search Result

Gene id

30968

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

STOML2 Gene UCSC Ensembl

Aliases

HSPC108, SLP-2

Gene name

stomatin like 2

Alternate names

stomatin-like protein 2, mitochondrial, EPB72-like 2, EPB72-like protein 2, paraprotein target 7, paratarg-7, stomatin (EPB72)-like 2,

Gene location

9p13.3 (35103194: 35099775) Exons: 10 NC_000009.12

OMIM

608292

Protein Summary

Protein general information

Q9UJZ1

Name: Stomatin like protein 2, mitochondrial (SLP 2) (EPB72 like protein 2) (Paraprotein target 7) (Paratarg 7)

Length: 356 Mass: 38,534

Tissue specificity: Ubiquitously expressed at low levels. Expressed in lymphoid tissues (at protein level). {ECO

Sequence

MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLNILIPVLDRIRY
VQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGKLSLDKVFRER
ESLNASIVDAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQ
ILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVKMS

Structural information

Interpro:	IPR001107 IPR032435 IPR001972
Pfam:	PF01145 PF16200
MINT:	2999996
STRING:	ENSP00000348886;

Other Databases

GeneCards: STOML2; Malacards: STOML2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005743	mitochondrial inner membr ane	IDA	cellular_component
GO:0005758	mitochondrial intermembra ne space	IDA	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0006851	mitochondrial calcium ion transport	IMP	biological_process
GO:0006874	cellular calcium ion home ostasis	IMP	biological_process
GO:0007005	mitochondrion organizatio n	IMP	biological_process
GO:0010876	lipid localization	ISS	biological_process
GO:0010918	positive regulation of mi tochondrial membrane pote ntial	IMP	biological_process
GO:0019897	extrinsic component of pl asma membrane	IDA	cellular_component
GO:0032623	interleukin-2 production	ISS	biological_process
GO:0034982	mitochondrial protein pro cessing	ISS	biological_process
GO:0035710	CD4-positive, alpha-beta T cell activation	ISS	biological_process
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	IMP	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0050852	T cell receptor signaling pathway	IMP	biological_process
GO:0051020	GTPase binding	IPI	molecular_function
GO:0051259	protein oligomerization	IDA	biological_process
GO:0090297	positive regulation of mi tochondrial DNA replicati on	IMP	biological_process
GO:1900210	positive regulation of ca rdiolipin metabolic proce ss	IMP	biological_process
GO:1901612	cardiolipin binding	IDA	molecular_function
GO:1990046	stress-induced mitochondr ial fusion	ISS	biological_process
GO:0001772	immunological synapse	IDA	cellular_component
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0042101	T cell receptor complex	IDA	cellular_component
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005739	mitochondrion	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IEA	cellular_component
GO:0005743	mitochondrial inner membr ane	IDA	cellular_component
GO:0005758	mitochondrial intermembra ne space	IEA	cellular_component
GO:0005758	mitochondrial intermembra ne space	IDA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006851	mitochondrial calcium ion transport	IMP	biological_process
GO:0006874	cellular calcium ion home ostasis	IMP	biological_process
GO:0007005	mitochondrion organizatio n	IMP	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0010876	lipid localization	IEA	biological_process
GO:0010876	lipid localization	ISS	biological_process
GO:0010918	positive regulation of mi tochondrial membrane pote ntial	IMP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0019897	extrinsic component of pl asma membrane	IEA	cellular_component
GO:0019897	extrinsic component of pl asma membrane	IDA	cellular_component
GO:0032623	interleukin-2 production	IEA	biological_process
GO:0032623	interleukin-2 production	ISS	biological_process
GO:0034982	mitochondrial protein pro cessing	IEA	biological_process
GO:0034982	mitochondrial protein pro cessing	ISS	biological_process
GO:0035710	CD4-positive, alpha-beta T cell activation	IEA	biological_process
GO:0035710	CD4-positive, alpha-beta T cell activation	ISS	biological_process
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	IEA	biological_process
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	IMP	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0050852	T cell receptor signaling pathway	IMP	biological_process
GO:0051020	GTPase binding	IPI	molecular_function
GO:0051259	protein oligomerization	IDA	biological_process
GO:0090297	positive regulation of mi tochondrial DNA replicati on	IMP	biological_process
GO:1900210	positive regulation of ca rdiolipin metabolic proce ss	IMP	biological_process
GO:1901612	cardiolipin binding	IDA	molecular_function
GO:1990046	stress-induced mitochondr ial fusion	IEA	biological_process
GO:1990046	stress-induced mitochondr ial fusion	ISS	biological_process
GO:0001772	immunological synapse	IDA	cellular_component
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0042101	T cell receptor complex	IDA	cellular_component
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005743	mitochondrial inner membr ane	IDA	cellular_component
GO:0005758	mitochondrial intermembra ne space	IDA	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0006851	mitochondrial calcium ion transport	IMP	biological_process
GO:0006874	cellular calcium ion home ostasis	IMP	biological_process
GO:0007005	mitochondrion organizatio n	IMP	biological_process
GO:0010876	lipid localization	ISS	biological_process
GO:0010918	positive regulation of mi tochondrial membrane pote ntial	IMP	biological_process
GO:0019897	extrinsic component of pl asma membrane	IDA	cellular_component
GO:0032623	interleukin-2 production	ISS	biological_process
GO:0034982	mitochondrial protein pro cessing	ISS	biological_process
GO:0035710	CD4-positive, alpha-beta T cell activation	ISS	biological_process
GO:0042776	mitochondrial ATP synthes is coupled proton transpo rt	IMP	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0050852	T cell receptor signaling pathway	IMP	biological_process
GO:0051020	GTPase binding	IPI	molecular_function
GO:0051259	protein oligomerization	IDA	biological_process
GO:0090297	positive regulation of mi tochondrial DNA replicati on	IMP	biological_process
GO:1900210	positive regulation of ca rdiolipin metabolic proce ss	IMP	biological_process
GO:1901612	cardiolipin binding	IDA	molecular_function
GO:1990046	stress-induced mitochondr ial fusion	ISS	biological_process
GO:0001772	immunological synapse	IDA	cellular_component
GO:0008180	COP9 signalosome	IDA	cellular_component
GO:0015629	actin cytoskeleton	IDA	cellular_component
GO:0042101	T cell receptor complex	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 22158085
Endometriosis	INFBASE22158085

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22158085	Endometrio sis			147 (35 early e ndometriosis, 5 5 advanced endo metriosis, 57 w ithout endometr iosis)		SLP2	Show abstract