Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 3117
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol HLA-DQA1   Gene   UCSC   Ensembl
Aliases CELIAC1, DQ-A1, HLA-DQA
Gene name major histocompatibility complex, class II, DQ alpha 1
Alternate names HLA class II histocompatibility antigen, DQ alpha 1 chain, DC-1 alpha chain, DC-alpha, HLA-DCA, MHC HLA-DQ alpha, MHC class II DQA1, MHC class II HLA-DQ-alpha-1,
Gene location 6p21.32 (32637402: 32654845)     Exons: 6     NC_000006.12
Gene summary(Entrez) HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq, Jul 2008]
OMIM 146880

Protein Summary

Protein general information P01909  

Name: HLA class II histocompatibility antigen, DQ alpha 1 chain (DC 1 alpha chain) (DC alpha) (HLA DCA) (MHC class II DQA1)

Length: 254  Mass: 27,805

Sequence MILNKALMLGALALTTVMSPCGGEDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLR
QFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNG
HSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLS
VGLVGIVVGTVFIIRGLRSVGASRHQGPL
Structural information
Protein Domains
Ig-like (112-204)
Interpro:  IPR032431 IPR007110 IPR013783 IPR003006 IPR003597 IPR011162 IPR014745 IPR001003
Prosite:   PS50835 PS00290

Pfam:  
PF07654 PF16196 PF00993

PDB:  
1JK8 1NBN 1S9V 1UVQ 2NNA 4GG6 4OZF 4OZG 4OZH 4OZI 5KSA 5KSB
PDBsum:   1JK8 1NBN 1S9V 1UVQ 2NNA 4GG6 4OZF 4OZG 4OZH 4OZI 5KSA 5KSB
Other Databases GeneCards:  HLA-DQA1;  Malacards:  HLA-DQA1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000139 Golgi membrane
TAS cellular_component
GO:0000139 Golgi membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
NAS cellular_component
GO:0005887 integral component of pla
sma membrane
NAS cellular_component
GO:0006955 immune response
NAS biological_process
GO:0006955 immune response
NAS biological_process
GO:0010008 endosome membrane
IEA cellular_component
GO:0012507 ER to Golgi transport ves
icle membrane
TAS cellular_component
GO:0012507 ER to Golgi transport ves
icle membrane
TAS cellular_component
GO:0016020 membrane
IDA cellular_component
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
TAS biological_process
GO:0030658 transport vesicle membran
e
TAS cellular_component
GO:0030658 transport vesicle membran
e
TAS cellular_component
GO:0030666 endocytic vesicle membran
e
TAS cellular_component
GO:0030666 endocytic vesicle membran
e
TAS cellular_component
GO:0030669 clathrin-coated endocytic
vesicle membrane
TAS cellular_component
GO:0030669 clathrin-coated endocytic
vesicle membrane
TAS cellular_component
GO:0031295 T cell costimulation
TAS biological_process
GO:0032395 MHC class II receptor act
ivity
TAS molecular_function
GO:0032395 MHC class II receptor act
ivity
NAS molecular_function
GO:0032395 MHC class II receptor act
ivity
NAS molecular_function
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0042605 peptide antigen binding
ISS molecular_function
GO:0042613 MHC class II protein comp
lex
ISS cellular_component
GO:0050852 T cell receptor signaling
pathway
TAS biological_process
GO:0060333 interferon-gamma-mediated
signaling pathway
TAS biological_process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0000139 Golgi membrane
TAS cellular_component
GO:0000139 Golgi membrane
TAS cellular_component
GO:0002376 immune system process
IEA biological_process
GO:0002504 antigen processing and pr
esentation of peptide or
polysaccharide antigen vi
a MHC class II
IEA biological_process
GO:0005764 lysosome
IEA cellular_component
GO:0005765 lysosomal membrane
IEA cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005768 endosome
IEA cellular_component
GO:0005783 endoplasmic reticulum
IEA cellular_component
GO:0005789 endoplasmic reticulum mem
brane
IEA cellular_component
GO:0005794 Golgi apparatus
IEA cellular_component
GO:0005794 Golgi apparatus
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
IEA cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
NAS cellular_component
GO:0005887 integral component of pla
sma membrane
NAS cellular_component
GO:0006955 immune response
IEA biological_process
GO:0006955 immune response
NAS biological_process
GO:0006955 immune response
NAS biological_process
GO:0010008 endosome membrane
IEA cellular_component
GO:0012507 ER to Golgi transport ves
icle membrane
TAS cellular_component
GO:0012507 ER to Golgi transport ves
icle membrane
TAS cellular_component
GO:0016020 membrane
IEA cellular_component
GO:0016020 membrane
IEA cellular_component
GO:0016020 membrane
IDA cellular_component
GO:0016021 integral component of mem
brane
IEA cellular_component
GO:0019882 antigen processing and pr
esentation
IEA biological_process
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
TAS biological_process
GO:0030658 transport vesicle membran
e
TAS cellular_component
GO:0030658 transport vesicle membran
e
TAS cellular_component
GO:0030666 endocytic vesicle membran
e
TAS cellular_component
GO:0030666 endocytic vesicle membran
e
TAS cellular_component
GO:0030669 clathrin-coated endocytic
vesicle membrane
TAS cellular_component
GO:0030669 clathrin-coated endocytic
vesicle membrane
TAS cellular_component
GO:0031295 T cell costimulation
TAS biological_process
GO:0032395 MHC class II receptor act
ivity
TAS molecular_function
GO:0032395 MHC class II receptor act
ivity
NAS molecular_function
GO:0032395 MHC class II receptor act
ivity
NAS molecular_function
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0042605 peptide antigen binding
ISS molecular_function
GO:0042613 MHC class II protein comp
lex
IEA cellular_component
GO:0042613 MHC class II protein comp
lex
IEA cellular_component
GO:0042613 MHC class II protein comp
lex
ISS cellular_component
GO:0050852 T cell receptor signaling
pathway
TAS biological_process
GO:0060333 interferon-gamma-mediated
signaling pathway
TAS biological_process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0000139 Golgi membrane
TAS cellular_component
GO:0000139 Golgi membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005765 lysosomal membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005886 plasma membrane
TAS cellular_component
GO:0005887 integral component of pla
sma membrane
NAS cellular_component
GO:0005887 integral component of pla
sma membrane
NAS cellular_component
GO:0006955 immune response
NAS biological_process
GO:0006955 immune response
NAS biological_process
GO:0012507 ER to Golgi transport ves
icle membrane
TAS cellular_component
GO:0012507 ER to Golgi transport ves
icle membrane
TAS cellular_component
GO:0016020 membrane
IDA cellular_component
GO:0019886 antigen processing and pr
esentation of exogenous p
eptide antigen via MHC cl
ass II
TAS biological_process
GO:0030658 transport vesicle membran
e
TAS cellular_component
GO:0030658 transport vesicle membran
e
TAS cellular_component
GO:0030666 endocytic vesicle membran
e
TAS cellular_component
GO:0030666 endocytic vesicle membran
e
TAS cellular_component
GO:0030669 clathrin-coated endocytic
vesicle membrane
TAS cellular_component
GO:0030669 clathrin-coated endocytic
vesicle membrane
TAS cellular_component
GO:0031295 T cell costimulation
TAS biological_process
GO:0032395 MHC class II receptor act
ivity
TAS molecular_function
GO:0032395 MHC class II receptor act
ivity
NAS molecular_function
GO:0032395 MHC class II receptor act
ivity
NAS molecular_function
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0032588 trans-Golgi network membr
ane
TAS cellular_component
GO:0042605 peptide antigen binding
ISS molecular_function
GO:0042613 MHC class II protein comp
lex
ISS cellular_component
GO:0050852 T cell receptor signaling
pathway
TAS biological_process
GO:0060333 interferon-gamma-mediated
signaling pathway
TAS biological_process
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component
GO:0071556 integral component of lum
enal side of endoplasmic
reticulum membrane
TAS cellular_component

KEGG pathways

hsa05166  HTLV-I infection
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05164  Influenza A
hsa05145  Toxoplasmosis
hsa04659  Th17 cell differentiation
hsa04514  Cell adhesion molecules
hsa04145  Phagosome
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa05140  Leishmaniasis
hsa04612  Antigen processing and presentation
hsa05332  Graft-versus-host disease
hsa05320  Autoimmune thyroid disease
hsa05416  Viral myocarditis
hsa05322  Systemic lupus erythematosus
hsa05330  Allograft rejection
hsa04940  Type I diabetes mellitus
hsa04672  Intestinal immune network for IgA production
hsa05150  Staphylococcus aureus infection
hsa05310  Asthma

Diseases

Associated diseases References
Addison's disease PMID: 16849401
Adrenal insufficiency PMID: 19890026
Allergic rhinitis PMID: 14990915
Allergies PMID: 15853900
Ankylosing spondylitis PMID: 12021150
Antiphospholipid syndrome PMID: 11246532
Arthritis PMID: 11981324
Asthma PMID: 12890388
Autoimmune diseases PMID: 19210322
Biliary atresia PMID: 12100571
Calcinosis PMID: 19479859
Cancer PMID: 11097225
Cardiomyopathy PMID: 16225776
Celiac disease PMID: 15496201
Cholangitis PMID: 17257319
Chronic fatigue syndrome PMID: 16049290
Colorectal cancer PMID: 19251712
Congenital adrenal hyperplasia PMID: 15027205
Dermatitis PMID: 16836882
Dermatomyositis PMID: 18930994
Diabetes KEGG: H00408, PMID: 18978792
Diabetic retinopathy PMID: 15019597
Dilated cardiomyopathy KEGG: H00294
Endometriosis PMID: 11718025
Eosinophilia Myalgia Syndrome PMID: 19790128
Glomerulonephritis PMID: 21323541
Graves disease KEGG: H00082
Guillain-Barre syndrome PMID: 11776098
Hashimoto's thyroiditis KEGG: H00081
Immune infertility PMID: 21485073
Juvenile arthritis PMID: 15703957
Juvenile dermatomyositis PMID: 1783570
Male gamete function PMID: 10611211
Multiple sclerosis PMID: 15613143
Myasthenia gravis PMID: 14700596
Myositis PMID: 16507114
Nasal polyposis PMID: 16890076
Osteoarthritis PMID: 12594107
Osteoporosis PMID: 17498269
Pelvic inflammatory disease (PID) PMID: 15107633
Pemphigus PMID: 18780165
Polycystic ovary syndrome (PCOS) PMID: 1471701
Preeclampsia PMID: 18593440
Adenomyosis INFBASE11836687
Endometriosis INFBASE11718025
Premature ovarian failure(POF) PMID: 10084595
Primary biliary cirrhosis PMID: 11171832
Recurrent miscarriage PMID: 8579756
Recurrent miscarriage PMID: 15993714
Renal disease PMID: 11082516
Rheumatic heart disease PMID: 14602216
Rheumatoid arthritis PMID: 15077289
Schizophrenia PMID: 11920855
Sjogren's syndrome PMID: 12648281
Systemic lupus erythematosus PMID: 11997714, KEGG: H00080
Systemic sclerosis KEGG: H01492
Tubal factor infertility PMID: 12151439
Vogt-Koyanagi-Harada syndrome PMID: 11835809

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
11718025 Endometrio
sis
HLA-DQA1 * 0401, HLA-DQA1 * 0301
95 (51 patients
with endometri
osis, 44 contro
l women who had
laparoscopic s
terilization an
d without endom
etriosis)
HLA-DQA1
Show abstract
11836687 Endometrio
sis
HLA-DQA1*0301 and *0401
140 (51 cases o
f endometriosis
, 45 cases of a
denomyosis, 44
normal individu
als as the cont
rol)

Show abstract