Endometriosis Knowledgebase

Search Result

Gene id

3122

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HLA-DRA Gene UCSC Ensembl

Aliases

HLA-DRA1

Gene name

major histocompatibility complex, class II, DR alpha

Alternate names

HLA class II histocompatibility antigen, DR alpha chain, MHC class II antigen DRA, histocompatibility antigen HLA-DR alpha,

Gene location

6p21.32 (32439841: 32445045) Exons: 5 NC_000006.12

Gene summary(Entrez)

HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. DRA does not have polymorphisms in the peptide binding part and acts as the sole alpha chain for DRB1, DRB3, DRB4 and DRB5. [provided by RefSeq, Jul 2008]

OMIM

142860

Protein Summary

Protein general information

P01903

Name: HLA class II histocompatibility antigen, DR alpha chain (MHC class II antigen DRA)

Length: 254 Mass: 28,607

Sequence

MAISGVPVLGFFIIAVLMSAQESWAIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGR
FASFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPNVLICFIDKFTPPVVNVTWLRNG
KPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDVYDCRVEHWGLDEPLLKHWEFDAPSPLPETTENVVCALGLT
VGLVGIIIGTIFIIKGVRKSNAAERRGPL

Structural information

Protein Domains	Ig-like (112-204)
Interpro:	IPR007110 IPR036179 IPR013783 IPR003006 IPR003597 IPR011162 IPR014745 IPR001003
Prosite:	PS50835 PS00290
Pfam:	PF07654 PF00993
PDB:	1A6A 1AQD 1BX2 1D5M 1D5X 1D5Z 1D6E 1DLH 1FV1 1FYT 1H15 1HQR 1HXY 1J8H 1JWM 1JWS 1JWU 1KG0 1KLG 1KLU 1LO5 1PYW 1R5I 1SEB 1SJE 1SJH 1T5W 1T5X 1YMM 1ZGL 2FSE 2G9H 2IAM 2IAN 2ICW 2IPK 2OJE 2Q6W 2SEB 2WBJ 2XN9 3C5J 3L6F 3O6F 3PDO 3PGC 3PGD 3QXA 3QXD 3S4S 3S5L
PDBsum:	1A6A 1AQD 1BX2 1D5M 1D5X 1D5Z 1D6E 1DLH 1FV1 1FYT 1H15 1HQR 1HXY 1J8H 1JWM 1JWS 1JWU 1KG0 1KLG 1KLU 1LO5 1PYW 1R5I 1SEB 1SJE 1SJH 1T5W 1T5X 1YMM 1ZGL 2FSE 2G9H 2IAM 2IAN 2ICW 2IPK 2OJE 2Q6W 2SEB 2WBJ 2XN9 3C5J 3L6F 3O6F 3PDO 3PGC 3PGD 3QXA 3QXD 3S4S 3S5L
DIP:	6063
MINT:
STRING:	ENSP00000378786;

Other Databases

GeneCards: HLA-DRA; Malacards: HLA-DRA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological_process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological_process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological_process
GO:0002504	antigen processing and pr esentation of peptide or polysaccharide antigen vi a MHC class II	IDA	biological_process
GO:0002506	polysaccharide assembly w ith MHC class II protein complex	IDA	biological_process
GO:0005764	lysosome	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0006955	immune response	NAS	biological_process
GO:0006955	immune response	NAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	TAS	biological_process
GO:0023026	MHC class II protein comp lex binding	IDA	molecular_function
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031902	late endosome membrane	IDA	cellular_component
GO:0031902	late endosome membrane	IDA	cellular_component
GO:0032395	MHC class II receptor act ivity	NAS	molecular_function
GO:0032395	MHC class II receptor act ivity	NAS	molecular_function
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0050890	cognition	IMP	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002376	immune system process	IEA	biological_process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological_process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological_process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological_process
GO:0002504	antigen processing and pr esentation of peptide or polysaccharide antigen vi a MHC class II	IEA	biological_process
GO:0002504	antigen processing and pr esentation of peptide or polysaccharide antigen vi a MHC class II	IDA	biological_process
GO:0002506	polysaccharide assembly w ith MHC class II protein complex	IDA	biological_process
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IDA	cellular_component
GO:0005765	lysosomal membrane	IEA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005794	Golgi apparatus	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	NAS	biological_process
GO:0006955	immune response	NAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0010008	endosome membrane	IEA	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0019882	antigen processing and pr esentation	IEA	biological_process
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	TAS	biological_process
GO:0023026	MHC class II protein comp lex binding	IDA	molecular_function
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031902	late endosome membrane	IEA	cellular_component
GO:0031902	late endosome membrane	IDA	cellular_component
GO:0031902	late endosome membrane	IDA	cellular_component
GO:0032395	MHC class II receptor act ivity	NAS	molecular_function
GO:0032395	MHC class II receptor act ivity	NAS	molecular_function
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042613	MHC class II protein comp lex	IEA	cellular_component
GO:0042613	MHC class II protein comp lex	IEA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0050890	cognition	IMP	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological_process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological_process
GO:0002503	peptide antigen assembly with MHC class II protein complex	IDA	biological_process
GO:0002504	antigen processing and pr esentation of peptide or polysaccharide antigen vi a MHC class II	IDA	biological_process
GO:0002506	polysaccharide assembly w ith MHC class II protein complex	IDA	biological_process
GO:0005764	lysosome	IDA	cellular_component
GO:0005765	lysosomal membrane	IDA	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005765	lysosomal membrane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0006955	immune response	NAS	biological_process
GO:0006955	immune response	NAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0019886	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass II	TAS	biological_process
GO:0023026	MHC class II protein comp lex binding	IDA	molecular_function
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030658	transport vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030666	endocytic vesicle membran e	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0030669	clathrin-coated endocytic vesicle membrane	TAS	cellular_component
GO:0031295	T cell costimulation	TAS	biological_process
GO:0031902	late endosome membrane	IDA	cellular_component
GO:0031902	late endosome membrane	IDA	cellular_component
GO:0032395	MHC class II receptor act ivity	NAS	molecular_function
GO:0032395	MHC class II receptor act ivity	NAS	molecular_function
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0032588	trans-Golgi network membr ane	TAS	cellular_component
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042605	peptide antigen binding	IDA	molecular_function
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0042613	MHC class II protein comp lex	IDA	cellular_component
GO:0050852	T cell receptor signaling pathway	TAS	biological_process
GO:0050890	cognition	IMP	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component

KEGG pathways

hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05169  Epstein-Barr virus infection
hsa05168  Herpes simplex infection
hsa05164  Influenza A
hsa05166  HTLV-I infection
hsa05152  Tuberculosis
hsa05150  Staphylococcus aureus infection
hsa04940  Type I diabetes mellitus
hsa05416  Viral myocarditis
hsa05332  Graft-versus-host disease
hsa05330  Allograft rejection
hsa05320  Autoimmune thyroid disease
hsa05323  Rheumatoid arthritis
hsa05322  Systemic lupus erythematosus
hsa05310  Asthma
hsa04672  Intestinal immune network for IgA production
hsa04659  Th17 cell differentiation
hsa04658  Th1 and Th2 cell differentiation
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04145  Phagosome
hsa04514  Cell adhesion molecules

Diseases

Associated diseases	References
Uveomeningoencephalitic Syndrome	GAD19452015
Ulcerative colitis	GAD12073071
Systemic lupus erythematosus	GAD11324494
Stroke	GAD12373032
Spondyloarthropathies	GAD12117677
Scleroderma	GAD21779181
Sarcoidosis	GAD11320565
Rheumatoid arthritis	GAD11361223
Parkinson's disease	GAD20711177
Myasthenia gravis	GAD15301866
Multiple sclerosis	GAD11239948
Lupus erythematosus	GAD18204098
Alzheimer's disease	GAD19204726
Diabetes	GAD16698433
Crohn's disease	GAD11742191
Celiac disease	GAD3014038
Azoospermia	GAD22541561
Asthma	GAD19247692
Endometriosis	PubMed15831297

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15831297	Endometrio sis		Japanes e	97 (38 Japanese women with end ometriosis, 59 controls)		HLA-ABC HLA-DR CD54 CD40 CD58 CD80 and CD86	Show abstract
11526783	Endometrio sis					HLA-DR CD40 CD25	Show abstract