Endometriosis Knowledgebase

Search Result

Gene id

3135

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HLA-G Gene UCSC Ensembl

Aliases

MHC-G

Gene name

major histocompatibility complex, class I, G

Alternate names

HLA class I histocompatibility antigen, alpha chain G, HLA G antigen, HLA-G histocompatibility antigen, class I, G, MHC class I antigen G, b2 microglobulin,

Gene location

6p22.1 (29826966: 29831129) Exons: 9 NC_000006.12

Gene summary(Entrez)

HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail. [provided by RefSeq, Jul 2008]

OMIM

142871

Protein Summary

Protein general information

P17693

Name: HLA class I histocompatibility antigen, alpha chain G (HLA G antigen) (MHC class I antigen G)

Length: 338 Mass: 38,224

Tissue specificity: Expressed in trophoblasts.

Sequence

MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPW
VEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLAL
NEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATL
RCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Structural information

Protein Domains	Ig-like (209-299)
Interpro:	IPR007110 IPR013783 IPR003006 IPR003597 IPR011161 IPR011162 IPR001039
Prosite:	PS50835 PS00290
Pfam:	PF07654 PF00129
PDB:	1YDP 2D31 2DYP 3BZE 3CDG 3CII 3KYN 3KYO
PDBsum:	1YDP 2D31 2DYP 3BZE 3CDG 3CII 3KYN 3KYO
DIP:	46121
STRING:	ENSP00000353472;

Other Databases

GeneCards: HLA-G; Malacards: HLA-G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002474	antigen processing and pr esentation of peptide ant igen via MHC class I	TAS	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0002480	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-independent	TAS	biological_process
GO:0002645	positive regulation of to lerance induction	IMP	biological_process
GO:0002666	positive regulation of T cell tolerance induction	IMP	biological_process
GO:0002767	immune response-inhibitin g cell surface receptor s ignaling pathway	IDA	biological_process
GO:0003823	antigen binding	IBA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006968	cellular defense response	TAS	biological_process
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0019882	antigen processing and pr esentation	IBA	biological_process
GO:0030670	phagocytic vesicle membra ne	TAS	cellular_component
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological_process
GO:0042130	negative regulation of T cell proliferation	IDA	biological_process
GO:0042605	peptide antigen binding	IEA	molecular_function
GO:0042612	MHC class I protein compl ex	IEA	cellular_component
GO:0042803	protein homodimerization activity	NAS	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0045591	positive regulation of re gulatory T cell different iation	IMP	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050777	negative regulation of im mune response	IC	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:2001199	negative regulation of de ndritic cell differentiat ion	IDA	biological_process
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002376	immune system process	IEA	biological_process
GO:0002474	antigen processing and pr esentation of peptide ant igen via MHC class I	IEA	biological_process
GO:0002474	antigen processing and pr esentation of peptide ant igen via MHC class I	IEA	biological_process
GO:0002474	antigen processing and pr esentation of peptide ant igen via MHC class I	TAS	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0002480	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-independent	TAS	biological_process
GO:0002645	positive regulation of to lerance induction	IMP	biological_process
GO:0002666	positive regulation of T cell tolerance induction	IMP	biological_process
GO:0002767	immune response-inhibitin g cell surface receptor s ignaling pathway	IDA	biological_process
GO:0003823	antigen binding	IBA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006955	immune response	IEA	biological_process
GO:0006968	cellular defense response	TAS	biological_process
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019882	antigen processing and pr esentation	IBA	biological_process
GO:0030670	phagocytic vesicle membra ne	TAS	cellular_component
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological_process
GO:0042130	negative regulation of T cell proliferation	IDA	biological_process
GO:0042605	peptide antigen binding	IEA	molecular_function
GO:0042612	MHC class I protein compl ex	IEA	cellular_component
GO:0042612	MHC class I protein compl ex	IEA	cellular_component
GO:0042803	protein homodimerization activity	NAS	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0045591	positive regulation of re gulatory T cell different iation	IMP	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050777	negative regulation of im mune response	IC	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:2001199	negative regulation of de ndritic cell differentiat ion	IDA	biological_process
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0000139	Golgi membrane	TAS	cellular_component
GO:0002474	antigen processing and pr esentation of peptide ant igen via MHC class I	TAS	biological_process
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0002480	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-independent	TAS	biological_process
GO:0002645	positive regulation of to lerance induction	IMP	biological_process
GO:0002666	positive regulation of T cell tolerance induction	IMP	biological_process
GO:0002767	immune response-inhibitin g cell surface receptor s ignaling pathway	IDA	biological_process
GO:0003823	antigen binding	IBA	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005102	receptor binding	IPI	molecular_function
GO:0005886	plasma membrane	IBA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006968	cellular defense response	TAS	biological_process
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0012507	ER to Golgi transport ves icle membrane	TAS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0019882	antigen processing and pr esentation	IBA	biological_process
GO:0030670	phagocytic vesicle membra ne	TAS	cellular_component
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0031901	early endosome membrane	TAS	cellular_component
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological_process
GO:0042130	negative regulation of T cell proliferation	IDA	biological_process
GO:0042803	protein homodimerization activity	NAS	molecular_function
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0045591	positive regulation of re gulatory T cell different iation	IMP	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050777	negative regulation of im mune response	IC	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:0071556	integral component of lum enal side of endoplasmic reticulum membrane	TAS	cellular_component
GO:2001199	negative regulation of de ndritic cell differentiat ion	IDA	biological_process

KEGG pathways

hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
hsa04144  Endocytosis
hsa04514  Cell adhesion molecules
hsa04650  Natural killer cell mediated cytotoxicity
hsa04145  Phagosome
hsa04612  Antigen processing and presentation
hsa05332  Graft-versus-host disease
hsa05320  Autoimmune thyroid disease
hsa05416  Viral myocarditis
hsa05330  Allograft rejection
hsa04940  Type I diabetes mellitus

Diseases

Associated diseases	References
Asthma	PMID: 19247692
Behcet's disease	PMID: 20622878
Cancer	PMID: 18721275
Coronary aneurysm	PMID: 18976687
Crohn's disease	PMID: 17446213
Diabetes	PMID: 18830248
Endometrial cancer	PMID: 16530254
Endometriosis	PMID: 17509578
Hyperandrogenism	PMID: 25403326
Implantation failure	PMID: 26742443
Multiple sclerosis	PMID: 17462509
Ovarian endometriosis	PMID: 19300397
Peritoneal endometriosis	PMID: 16311290
Polycystic ovary syndrome (PCOS)	PMID: 25403326
Preeclampsia	PMID: 17493150
Ovarian endometriosis	INFBASE19300397
Adenomyosis	INFBASE17953947
Endometriosis	INFBASE17509578
Peritoneal endometriosis	INFBASE16311290
Primary unexplained infertility	PMID: 25764161
Psoriasis	PMID: 18797896
Recurrent implantation failure (RIF)	PMID: 25367742
Recurrent pregnancy loss (RPL)/ Abortion/ Miscarriage/ Recurrent pregnancy failure/Pregnancy loss/ Recurrent miscarriage/ Spontaneous abortion	PMID: 15191524
Reduced fertility	PMID: 22114131
Reduced sperm quality	PMID: 24735563
Reproductive failure	PMID: 18292821
Sarcoidosis	PMID: 16933468
Sickle cell anemia	PMID: 19775370
Systemic lupus erythematosus	PMID: 18380776

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
17953947	Endometrio sis	45 (34 patients with adenomyos is, 11 with myo ma of the uteru s)	HLA-G	Show abstract
17509578	Endometrio sis		HLA-G	Show abstract
19300397	Ovarian en dometriosi s	140 (98 women w ho underwent la parotomies or l aparoscopies du e to either ova rian endometrio sis or leiomyom atous uterus, 4 2 women control s)	HLA-G	Show abstract
16311290	Peritoneal endometri osis	68 (archived ti ssue blocks fro m peritoneal en dometriotic les ions (n = 15) a nd eutopic endo metrium (n = 12 ) were evaluate d for extent of protein immuno staining, and ( ii) eutopic end ometrial biopsi es from women w ithout (n = 17) and with (n = 24) endometrios	HLA-G	Show abstract