Endometriosis Knowledgebase

Search Result

Gene id

3146

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HMGB1 Gene UCSC Ensembl

Aliases

HMG-1, HMG1, HMG3, SBP-1

Gene name

high mobility group box 1

Alternate names

high mobility group protein B1, Amphoterin, Sulfoglucuronyl carbohydrate binding protein, high-mobility group (nonhistone chromosomal) protein 1,

Gene location

13q12.3 (30617596: 30457915) Exons: 7 NC_000013.11

Gene summary(Entrez)

This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]

OMIM

163905

Protein Summary

Protein general information

P09429

Name: High mobility group protein B1 (High mobility group protein 1) (HMG 1)

Length: 215 Mass: 24,894

Tissue specificity: Ubiquituous. Expressed in platelets (PubMed

Sequence

MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREM
KTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK
LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Structural information

Motifs	Nuclear localization(27-43) Nuclear localization(178-184)
Interpro:	IPR009071 IPR017967
Prosite:	PS00353 PS50118
Pfam:	PF00505 PF09011
PDB:	2LY4 2RTU 2YRQ
PDBsum:	2LY4 2RTU 2YRQ
DIP:	24195
MINT:	153055
STRING:	ENSP00000343040;

Other Databases

GeneCards: HMGB1; Malacards: HMGB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000400	four-way junction DNA bin ding	ISS	molecular_function
GO:0000405	bubble DNA binding	ISS	molecular_function
GO:0000793	condensed chromosome	IDA	cellular_component
GO:0001530	lipopolysaccharide bindin g	IDA	molecular_function
GO:0001654	eye development	IEA	biological_process
GO:0001773	myeloid dendritic cell ac tivation	ISS	biological_process
GO:0001786	phosphatidylserine bindin g	IDA	molecular_function
GO:0001935	endothelial cell prolifer ation	IEA	biological_process
GO:0002218	activation of innate immu ne response	IDA	biological_process
GO:0002270	plasmacytoid dendritic ce ll activation	IEA	biological_process
GO:0002281	macrophage activation inv olved in immune response	IEA	biological_process
GO:0002407	dendritic cell chemotaxis	ISS	biological_process
GO:0002437	inflammatory response to antigenic stimulus	IEP	biological_process
GO:0002643	regulation of tolerance i nduction	IDA	biological_process
GO:0002840	regulation of T cell medi ated immune response to t umor cell	ISS	biological_process
GO:0003684	damaged DNA binding	ISS	molecular_function
GO:0003684	damaged DNA binding	IDA	molecular_function
GO:0003690	double-stranded DNA bindi ng	ISS	molecular_function
GO:0003697	single-stranded DNA bindi ng	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003725	double-stranded RNA bindi ng	IEA	molecular_function
GO:0003727	single-stranded RNA bindi ng	IEA	molecular_function
GO:0005125	cytokine activity	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005793	endoplasmic reticulum-Gol gi intermediate compartme nt	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006265	DNA topological change	ISS	biological_process
GO:0006284	base-excision repair	IEA	biological_process
GO:0006309	apoptotic DNA fragmentati on	TAS	biological_process
GO:0006310	DNA recombination	ISS	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological_process
GO:0006914	autophagy	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IDA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008301	DNA binding, bending	ISS	molecular_function
GO:0008301	DNA binding, bending	ISS	molecular_function
GO:0008301	DNA binding, bending	IMP	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0010506	regulation of autophagy	IMP	biological_process
GO:0010858	calcium-dependent protein kinase regulator activit y	IEA	molecular_function
GO:0016829	lyase activity	IDA	molecular_function
GO:0017055	negative regulation of RN A polymerase II transcrip tional preinitiation comp lex assembly	IDA	biological_process
GO:0019958	C-X-C chemokine binding	IDA	molecular_function
GO:0030295	protein kinase activator activity	IEA	molecular_function
GO:0030324	lung development	IEA	biological_process
GO:0031175	neuron projection develop ment	ISS	biological_process
GO:0031497	chromatin assembly	IEA	biological_process
GO:0032072	regulation of restriction endodeoxyribonuclease ac tivity	IDA	biological_process
GO:0032147	activation of protein kin ase activity	IEA	biological_process
GO:0032392	DNA geometric change	ISS	biological_process
GO:0032425	positive regulation of mi smatch repair	IDA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IDA	biological_process
GO:0032727	positive regulation of in terferon-alpha production	IEA	biological_process
GO:0032728	positive regulation of in terferon-beta production	IEA	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IDA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IMP	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0033151	V(D)J recombination	IDA	biological_process
GO:0034137	positive regulation of to ll-like receptor 2 signal ing pathway	IEA	biological_process
GO:0034145	positive regulation of to ll-like receptor 4 signal ing pathway	IEA	biological_process
GO:0034165	positive regulation of to ll-like receptor 9 signal ing pathway	ISS	biological_process
GO:0035711	T-helper 1 cell activatio n	IDA	biological_process
GO:0035767	endothelial cell chemotax is	IEA	biological_process
GO:0042056	chemoattractant activity	ISS	molecular_function
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IMP	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043277	apoptotic cell clearance	IDA	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0043371	negative regulation of CD 4-positive, alpha-beta T cell differentiation	IDA	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045063	T-helper 1 cell different iation	IMP	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045639	positive regulation of my eloid cell differentiatio n	IEA	biological_process
GO:0045819	positive regulation of gl ycogen catabolic process	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0050716	positive regulation of in terleukin-1 secretion	IDA	biological_process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IEA	biological_process
GO:0050786	RAGE receptor binding	ISS	molecular_function
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0051103	DNA ligation involved in DNA repair	ISS	biological_process
GO:0051106	positive regulation of DN A ligation	ISS	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070182	DNA polymerase binding	IDA	molecular_function
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:0090303	positive regulation of wo und healing	IEA	biological_process
GO:0097100	supercoiled DNA binding	ISS	molecular_function
GO:0097350	neutrophil clearance	IDA	biological_process
GO:1901224	positive regulation of NI K/NF-kappaB signaling	IEA	biological_process
GO:1903672	positive regulation of sp routing angiogenesis	IEA	biological_process
GO:1990774	tumor necrosis factor sec retion	IDA	biological_process
GO:2000426	negative regulation of ap optotic cell clearance	IEA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:2000819	regulation of nucleotide- excision repair	IEA	biological_process
GO:2001200	positive regulation of de ndritic cell differentiat ion	IMP	biological_process
GO:0017053	transcriptional repressor complex	IDA	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000400	four-way junction DNA bin ding	ISS	molecular_function
GO:0000405	bubble DNA binding	ISS	molecular_function
GO:0000793	condensed chromosome	IDA	cellular_component
GO:0001530	lipopolysaccharide bindin g	IDA	molecular_function
GO:0001654	eye development	IEA	biological_process
GO:0001773	myeloid dendritic cell ac tivation	IEA	biological_process
GO:0001773	myeloid dendritic cell ac tivation	ISS	biological_process
GO:0001786	phosphatidylserine bindin g	IDA	molecular_function
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0001935	endothelial cell prolifer ation	IEA	biological_process
GO:0002218	activation of innate immu ne response	IDA	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002270	plasmacytoid dendritic ce ll activation	IEA	biological_process
GO:0002281	macrophage activation inv olved in immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002407	dendritic cell chemotaxis	ISS	biological_process
GO:0002437	inflammatory response to antigenic stimulus	IEP	biological_process
GO:0002643	regulation of tolerance i nduction	IEA	biological_process
GO:0002643	regulation of tolerance i nduction	IDA	biological_process
GO:0002840	regulation of T cell medi ated immune response to t umor cell	IEA	biological_process
GO:0002840	regulation of T cell medi ated immune response to t umor cell	ISS	biological_process
GO:0003677	DNA binding	IEA	molecular_function
GO:0003677	DNA binding	IEA	molecular_function
GO:0003684	damaged DNA binding	ISS	molecular_function
GO:0003684	damaged DNA binding	IDA	molecular_function
GO:0003690	double-stranded DNA bindi ng	IEA	molecular_function
GO:0003690	double-stranded DNA bindi ng	ISS	molecular_function
GO:0003697	single-stranded DNA bindi ng	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0003725	double-stranded RNA bindi ng	IEA	molecular_function
GO:0003727	single-stranded RNA bindi ng	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0005694	chromosome	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005769	early endosome	IEA	cellular_component
GO:0005793	endoplasmic reticulum-Gol gi intermediate compartme nt	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0006265	DNA topological change	ISS	biological_process
GO:0006281	DNA repair	IEA	biological_process
GO:0006284	base-excision repair	IEA	biological_process
GO:0006309	apoptotic DNA fragmentati on	TAS	biological_process
GO:0006310	DNA recombination	ISS	biological_process
GO:0006310	DNA recombination	IEA	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological_process
GO:0006914	autophagy	IEA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IDA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008301	DNA binding, bending	ISS	molecular_function
GO:0008301	DNA binding, bending	ISS	molecular_function
GO:0008301	DNA binding, bending	IMP	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0010506	regulation of autophagy	IEA	biological_process
GO:0010506	regulation of autophagy	IMP	biological_process
GO:0010858	calcium-dependent protein kinase regulator activit y	IEA	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016829	lyase activity	IDA	molecular_function
GO:0017055	negative regulation of RN A polymerase II transcrip tional preinitiation comp lex assembly	IDA	biological_process
GO:0019958	C-X-C chemokine binding	IDA	molecular_function
GO:0030295	protein kinase activator activity	IEA	molecular_function
GO:0030324	lung development	IEA	biological_process
GO:0031175	neuron projection develop ment	ISS	biological_process
GO:0031497	chromatin assembly	IEA	biological_process
GO:0032072	regulation of restriction endodeoxyribonuclease ac tivity	IDA	biological_process
GO:0032147	activation of protein kin ase activity	IEA	biological_process
GO:0032392	DNA geometric change	ISS	biological_process
GO:0032425	positive regulation of mi smatch repair	IDA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IDA	biological_process
GO:0032727	positive regulation of in terferon-alpha production	IEA	biological_process
GO:0032728	positive regulation of in terferon-beta production	IEA	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IDA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IMP	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0033151	V(D)J recombination	IDA	biological_process
GO:0034137	positive regulation of to ll-like receptor 2 signal ing pathway	IEA	biological_process
GO:0034145	positive regulation of to ll-like receptor 4 signal ing pathway	IEA	biological_process
GO:0034165	positive regulation of to ll-like receptor 9 signal ing pathway	ISS	biological_process
GO:0035711	T-helper 1 cell activatio n	IDA	biological_process
GO:0035767	endothelial cell chemotax is	IEA	biological_process
GO:0042056	chemoattractant activity	ISS	molecular_function
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IMP	biological_process
GO:0043005	neuron projection	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043277	apoptotic cell clearance	IDA	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0043371	negative regulation of CD 4-positive, alpha-beta T cell differentiation	IDA	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045063	T-helper 1 cell different iation	IMP	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045089	positive regulation of in nate immune response	IEA	biological_process
GO:0045639	positive regulation of my eloid cell differentiatio n	IEA	biological_process
GO:0045819	positive regulation of gl ycogen catabolic process	IEA	biological_process
GO:0045859	regulation of protein kin ase activity	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0050716	positive regulation of in terleukin-1 secretion	IDA	biological_process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IEA	biological_process
GO:0050786	RAGE receptor binding	ISS	molecular_function
GO:0050918	positive chemotaxis	IEA	biological_process
GO:0051103	DNA ligation involved in DNA repair	ISS	biological_process
GO:0051106	positive regulation of DN A ligation	ISS	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070182	DNA polymerase binding	IDA	molecular_function
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:0090303	positive regulation of wo und healing	IEA	biological_process
GO:0097100	supercoiled DNA binding	ISS	molecular_function
GO:0097350	neutrophil clearance	IDA	biological_process
GO:1901224	positive regulation of NI K/NF-kappaB signaling	IEA	biological_process
GO:1903672	positive regulation of sp routing angiogenesis	IEA	biological_process
GO:1990774	tumor necrosis factor sec retion	IDA	biological_process
GO:2000426	negative regulation of ap optotic cell clearance	IEA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:2000819	regulation of nucleotide- excision repair	IEA	biological_process
GO:2001200	positive regulation of de ndritic cell differentiat ion	IMP	biological_process
GO:0017053	transcriptional repressor complex	IDA	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0000400	four-way junction DNA bin ding	ISS	molecular_function
GO:0000405	bubble DNA binding	ISS	molecular_function
GO:0000793	condensed chromosome	IDA	cellular_component
GO:0001530	lipopolysaccharide bindin g	IDA	molecular_function
GO:0001773	myeloid dendritic cell ac tivation	ISS	biological_process
GO:0001786	phosphatidylserine bindin g	IDA	molecular_function
GO:0002218	activation of innate immu ne response	IDA	biological_process
GO:0002407	dendritic cell chemotaxis	ISS	biological_process
GO:0002437	inflammatory response to antigenic stimulus	IEP	biological_process
GO:0002643	regulation of tolerance i nduction	IDA	biological_process
GO:0002840	regulation of T cell medi ated immune response to t umor cell	ISS	biological_process
GO:0003684	damaged DNA binding	ISS	molecular_function
GO:0003684	damaged DNA binding	IDA	molecular_function
GO:0003690	double-stranded DNA bindi ng	ISS	molecular_function
GO:0003697	single-stranded DNA bindi ng	ISS	molecular_function
GO:0003700	transcription factor acti vity, sequence-specific D NA binding	IDA	molecular_function
GO:0005125	cytokine activity	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0006265	DNA topological change	ISS	biological_process
GO:0006309	apoptotic DNA fragmentati on	TAS	biological_process
GO:0006310	DNA recombination	ISS	biological_process
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IDA	biological_process
GO:0008134	transcription factor bind ing	IPI	molecular_function
GO:0008301	DNA binding, bending	ISS	molecular_function
GO:0008301	DNA binding, bending	ISS	molecular_function
GO:0008301	DNA binding, bending	IMP	molecular_function
GO:0009986	cell surface	IDA	cellular_component
GO:0010506	regulation of autophagy	IMP	biological_process
GO:0016829	lyase activity	IDA	molecular_function
GO:0017055	negative regulation of RN A polymerase II transcrip tional preinitiation comp lex assembly	IDA	biological_process
GO:0019958	C-X-C chemokine binding	IDA	molecular_function
GO:0031175	neuron projection develop ment	ISS	biological_process
GO:0032072	regulation of restriction endodeoxyribonuclease ac tivity	IDA	biological_process
GO:0032392	DNA geometric change	ISS	biological_process
GO:0032425	positive regulation of mi smatch repair	IDA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IDA	biological_process
GO:0032733	positive regulation of in terleukin-10 production	IDA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IMP	biological_process
GO:0033151	V(D)J recombination	IDA	biological_process
GO:0034165	positive regulation of to ll-like receptor 9 signal ing pathway	ISS	biological_process
GO:0035711	T-helper 1 cell activatio n	IDA	biological_process
GO:0042056	chemoattractant activity	ISS	molecular_function
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IMP	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043277	apoptotic cell clearance	IDA	biological_process
GO:0043280	positive regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IDA	biological_process
GO:0043371	negative regulation of CD 4-positive, alpha-beta T cell differentiation	IDA	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043537	negative regulation of bl ood vessel endothelial ce ll migration	IDA	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045063	T-helper 1 cell different iation	IMP	biological_process
GO:0045087	innate immune response	TAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IDA	biological_process
GO:0050716	positive regulation of in terleukin-1 secretion	IDA	biological_process
GO:0050786	RAGE receptor binding	ISS	molecular_function
GO:0051103	DNA ligation involved in DNA repair	ISS	biological_process
GO:0051106	positive regulation of DN A ligation	ISS	biological_process
GO:0070182	DNA polymerase binding	IDA	molecular_function
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IDA	biological_process
GO:0070491	repressing transcription factor binding	IPI	molecular_function
GO:0090026	positive regulation of mo nocyte chemotaxis	IDA	biological_process
GO:0097100	supercoiled DNA binding	ISS	molecular_function
GO:0097350	neutrophil clearance	IDA	biological_process
GO:1990774	tumor necrosis factor sec retion	IDA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IDA	biological_process
GO:2001200	positive regulation of de ndritic cell differentiat ion	IMP	biological_process
GO:0017053	transcriptional repressor complex	IDA	cellular_component

KEGG pathways

hsa04217  Necroptosis
hsa04140  Autophagy - animal
hsa03410  Base excision repair

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 21116278
Endometriosis	PMID: 26872033
Female infertility	PMID: 24488797
Implantation failure	PMID: 24488797
Premature ovarian failure ( POF)	PMID: 20522323
Endometriosis	INFBASE26872033
Sepsis	PMID: 18577209
Unexplained infertility	PMID: 20522323

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
26872033	Endometrio sis			60 (33 from end ometriosis, 27 controls)			Show abstract