Endometriosis Knowledgebase

Search Result

Gene id

3162

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HMOX1 Gene UCSC Ensembl

Aliases

HMOX1D, HO-1, HSP32, bK286B10

Gene name

heme oxygenase 1

Alternate names

heme oxygenase 1, heat shock protein, 32-kD, heme oxygenase (decycling) 1,

Gene location

22q12.3 (35381066: 35394213) Exons: 5 NC_000022.11

Gene summary(Entrez)

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008]

OMIM

141250

Protein Summary

Protein general information

P09601

Name: Heme oxygenase 1 (HO 1) (EC 1.14.14.18)

Length: 288 Mass: 32,819

Tissue specificity: Expressed at higher levels in renal cancer tissue than in normal tissue (at protein level). {ECO

Sequence

MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFA
PVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKI
AQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDT
KDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM

Structural information

Interpro:	IPR002051 IPR016053 IPR016084 IPR018207
Prosite:	PS00593
Pfam:	PF01126
CDD:	cd00232
PDB:	1N3U 1N45 1NI6 1OYK 1OYL 1OZE 1OZL 1OZR 1OZW 1S13 1S8C 1T5P 1TWN 1TWR 1XJZ 1XK0 1XK1 1XK2 1XK3 3CZY 3HOK 3K4F 3TGM 4WD4 5BTQ
PDBsum:	1N3U 1N45 1NI6 1OYK 1OYL 1OZE 1OZL 1OZR 1OZW 1S13 1S8C 1T5P 1TWN 1TWR 1XJZ 1XK0 1XK1 1XK2 1XK3 3CZY 3HOK 3K4F 3TGM 4WD4 5BTQ
STRING:	ENSP00000216117;

Other Databases

GeneCards: HMOX1; Malacards: HMOX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	TAS	biological_process
GO:0001935	endothelial cell prolifer ation	TAS	biological_process
GO:0002246	wound healing involved in inflammatory response	IMP	biological_process
GO:0002686	negative regulation of le ukocyte migration	TAS	biological_process
GO:0004392	heme oxygenase (decyclizi ng) activity	IDA	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	IMP	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	TAS	molecular_function
GO:0004630	phospholipase D activity	IEA	molecular_function
GO:0004871	signal transducer activit y	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	TAS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005901	caveola	IEA	cellular_component
GO:0006788	heme oxidation	IDA	biological_process
GO:0006879	cellular iron ion homeost asis	IMP	biological_process
GO:0006879	cellular iron ion homeost asis	TAS	biological_process
GO:0006979	response to oxidative str ess	IMP	biological_process
GO:0007264	small GTPase mediated sig nal transduction	IEA	biological_process
GO:0007588	excretion	IC	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008219	cell death	ISS	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IEA	biological_process
GO:0010656	negative regulation of mu scle cell apoptotic proce ss	IEA	biological_process
GO:0014806	smooth muscle hyperplasia	TAS	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0019899	enzyme binding	ISS	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0031670	cellular response to nutr ient	IEA	biological_process
GO:0032764	negative regulation of ma st cell cytokine producti on	IEA	biological_process
GO:0034101	erythrocyte homeostasis	IMP	biological_process
GO:0034383	low-density lipoprotein p article clearance	TAS	biological_process
GO:0034395	regulation of transcripti on from RNA polymerase II promoter in response to iron	IEA	biological_process
GO:0034605	cellular response to heat	IMP	biological_process
GO:0035094	response to nicotine	IDA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0042167	heme catabolic process	IDA	biological_process
GO:0042167	heme catabolic process	TAS	biological_process
GO:0042542	response to hydrogen pero xide	ISS	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043305	negative regulation of ma st cell degranulation	IEA	biological_process
GO:0043392	negative regulation of DN A binding	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	ISS	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	TAS	biological_process
GO:0045765	regulation of angiogenesi s	TAS	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045909	positive regulation of va sodilation	IC	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	ISS	biological_process
GO:0051260	protein homooligomerizati on	IDA	biological_process
GO:0055072	iron ion homeostasis	IDA	biological_process
GO:0055072	iron ion homeostasis	IMP	biological_process
GO:0071243	cellular response to arse nic-containing substance	IEA	biological_process
GO:0071276	cellular response to cadm ium ion	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEP	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IMP	biological_process
GO:0001525	angiogenesis	IEA	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001935	endothelial cell prolifer ation	TAS	biological_process
GO:0002246	wound healing involved in inflammatory response	IMP	biological_process
GO:0002686	negative regulation of le ukocyte migration	TAS	biological_process
GO:0004392	heme oxygenase (decyclizi ng) activity	IEA	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	IEA	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	IDA	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	IMP	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	TAS	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	TAS	molecular_function
GO:0004630	phospholipase D activity	IEA	molecular_function
GO:0004871	signal transducer activit y	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	TAS	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005901	caveola	IEA	cellular_component
GO:0006788	heme oxidation	IEA	biological_process
GO:0006788	heme oxidation	IDA	biological_process
GO:0006879	cellular iron ion homeost asis	IMP	biological_process
GO:0006879	cellular iron ion homeost asis	TAS	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0006979	response to oxidative str ess	IEA	biological_process
GO:0006979	response to oxidative str ess	IMP	biological_process
GO:0007264	small GTPase mediated sig nal transduction	IEA	biological_process
GO:0007588	excretion	IC	biological_process
GO:0008217	regulation of blood press ure	IEA	biological_process
GO:0008219	cell death	IEA	biological_process
GO:0008219	cell death	ISS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008630	intrinsic apoptotic signa ling pathway in response to DNA damage	IEA	biological_process
GO:0010656	negative regulation of mu scle cell apoptotic proce ss	IEA	biological_process
GO:0014806	smooth muscle hyperplasia	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	TAS	cellular_component
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0019899	enzyme binding	IEA	molecular_function
GO:0019899	enzyme binding	ISS	molecular_function
GO:0020037	heme binding	IEA	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0031670	cellular response to nutr ient	IEA	biological_process
GO:0032764	negative regulation of ma st cell cytokine producti on	IEA	biological_process
GO:0034101	erythrocyte homeostasis	IMP	biological_process
GO:0034383	low-density lipoprotein p article clearance	TAS	biological_process
GO:0034395	regulation of transcripti on from RNA polymerase II promoter in response to iron	IEA	biological_process
GO:0034605	cellular response to heat	IMP	biological_process
GO:0035094	response to nicotine	IDA	biological_process
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0042167	heme catabolic process	IEA	biological_process
GO:0042167	heme catabolic process	IDA	biological_process
GO:0042167	heme catabolic process	TAS	biological_process
GO:0042168	heme metabolic process	IEA	biological_process
GO:0042542	response to hydrogen pero xide	IEA	biological_process
GO:0042542	response to hydrogen pero xide	ISS	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043305	negative regulation of ma st cell degranulation	IEA	biological_process
GO:0043392	negative regulation of DN A binding	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IEA	biological_process
GO:0043524	negative regulation of ne uron apoptotic process	IEA	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	IEA	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	ISS	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	TAS	biological_process
GO:0045765	regulation of angiogenesi s	TAS	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045909	positive regulation of va sodilation	IC	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	IEA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	ISS	biological_process
GO:0051260	protein homooligomerizati on	IDA	biological_process
GO:0055072	iron ion homeostasis	IDA	biological_process
GO:0055072	iron ion homeostasis	IMP	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0071243	cellular response to arse nic-containing substance	IEA	biological_process
GO:0071276	cellular response to cadm ium ion	IEA	biological_process
GO:0071456	cellular response to hypo xia	IEP	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IMP	biological_process
GO:0001525	angiogenesis	TAS	biological_process
GO:0001935	endothelial cell prolifer ation	TAS	biological_process
GO:0002246	wound healing involved in inflammatory response	IMP	biological_process
GO:0002686	negative regulation of le ukocyte migration	TAS	biological_process
GO:0004392	heme oxygenase (decyclizi ng) activity	IDA	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	IMP	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	TAS	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	TAS	molecular_function
GO:0004871	signal transducer activit y	IMP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	TAS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005783	endoplasmic reticulum	ISS	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	IDA	cellular_component
GO:0005783	endoplasmic reticulum	TAS	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0006788	heme oxidation	IDA	biological_process
GO:0006879	cellular iron ion homeost asis	IMP	biological_process
GO:0006879	cellular iron ion homeost asis	TAS	biological_process
GO:0006979	response to oxidative str ess	IMP	biological_process
GO:0007588	excretion	IC	biological_process
GO:0008219	cell death	ISS	biological_process
GO:0014806	smooth muscle hyperplasia	TAS	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0019899	enzyme binding	ISS	molecular_function
GO:0020037	heme binding	IDA	molecular_function
GO:0034101	erythrocyte homeostasis	IMP	biological_process
GO:0034383	low-density lipoprotein p article clearance	TAS	biological_process
GO:0034605	cellular response to heat	IMP	biological_process
GO:0035094	response to nicotine	IDA	biological_process
GO:0035556	intracellular signal tran sduction	TAS	biological_process
GO:0042167	heme catabolic process	IDA	biological_process
GO:0042167	heme catabolic process	TAS	biological_process
GO:0042542	response to hydrogen pero xide	ISS	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IMP	biological_process
GO:0043619	regulation of transcripti on from RNA polymerase II promoter in response to oxidative stress	ISS	biological_process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	TAS	biological_process
GO:0045765	regulation of angiogenesi s	TAS	biological_process
GO:0045909	positive regulation of va sodilation	IC	biological_process
GO:0048471	perinuclear region of cyt oplasm	IDA	cellular_component
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0051090	regulation of sequence-sp ecific DNA binding transc ription factor activity	ISS	biological_process
GO:0051260	protein homooligomerizati on	IDA	biological_process
GO:0055072	iron ion homeostasis	IDA	biological_process
GO:0055072	iron ion homeostasis	IMP	biological_process
GO:0071456	cellular response to hypo xia	IEP	biological_process
GO:1902042	negative regulation of ex trinsic apoptotic signali ng pathway via death doma in receptors	IMP	biological_process

KEGG pathways

hsa01100  Metabolic pathways
hsa05206  MicroRNAs in cancer
hsa05418  Fluid shear stress and atherosclerosis
hsa04066  HIF-1 signaling pathway
hsa04216  Ferroptosis
hsa04978  Mineral absorption
hsa00860  Porphyrin and chlorophyll metabolism

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 9225984
Azoospermia	PMID: 21898994
Cancer	PMID: 19255063
Chronic obstructive pulmonary disease (COPD)	PMID: 12149538
Chronic toxic encephalopathy	PMID: 14992466
Coronary artery disease	PMID: 12136229
Diabetes	PMID: 19696228
Emphysema	PMID: 12579334
Endometriosis	PMID: 11872213
Female infertility	PMID: 24607880
Glomerulonephritis	PMID: 19194559
Inflammatory bowel disease	PMID: 18460015
Kawasaki disease	PMID: 14521259
Kidney disease	PMID: 19578796
Male infertility	PMID: 21556890
Metabolic syndrome	PMID: 19056482
Obesity	PMID: 19884647
Oligoasthenoteratozoospermia	PMID: 20629646
Oocyte competency	PMID: 24607880
Parkinson's disease	PMID: 19475336
Peritoneal endometriosis	PMID: 11872213
Peritoneal endometriosis	PMID: 11872213
Polycystic ovary syndrome (PCOS)	PMID: 24585089
Preeclampsia	PMID: 19399816
Peritoneal endometriosis	INFBASE11872213
Recurrent miscarriage	PMID: 14981149
Respiratory distress syndrome	PMID: 19526221
Restenosis	PMID: 11718398
Rheumatoid arthritis	PMID: 18975324

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11872213	Endometrio sis (Perit oneal)			76 (Patients un dergoing laparo scopy for tubal sterilization or infertility and/or pelvic p ain)			Show abstract