Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 3163
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol HMOX2   Gene   UCSC   Ensembl
Aliases HO-2
Gene name heme oxygenase 2
Alternate names heme oxygenase 2, heme oxygenase (decycling) 2,
Gene location 16p13.3 (4474696: 4510346)     Exons: 12     NC_000016.10
Gene summary(Entrez) Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]
OMIM 141251

Protein Summary

Protein general information P30519  

Name: Heme oxygenase 2 (HO 2) (EC 1.14.14.18)

Length: 316  Mass: 36,033

Sequence MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALY
FTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLV
AHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANK
AFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGVALAAGLLAWYYM
Structural information
Interpro:  IPR002051 IPR016053 IPR016084 IPR018207
Prosite:   PS00593

Pfam:  
PF01126
CDD:   cd00232

PDB:  
2Q32 2QPP 2RGZ 4WMH 5UC8 5UC9 5UCA
PDBsum:   2Q32 2QPP 2RGZ 4WMH 5UC8 5UC9 5UCA

DIP:  
53564
MINT:   1384587
STRING:   ENSP00000219700;
Other Databases GeneCards:  HMOX2;  Malacards:  HMOX2

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001666 response to hypoxia
IDA biological_process
GO:0004392 heme oxygenase (decyclizi
ng) activity
IDA molecular_function
GO:0004392 heme oxygenase (decyclizi
ng) activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0006788 heme oxidation
IEA biological_process
GO:0006879 cellular iron ion homeost
asis
TAS biological_process
GO:0016020 membrane
IDA cellular_component
GO:0042167 heme catabolic process
TAS biological_process
GO:0046872 metal ion binding
IEA molecular_function
GO:0001666 response to hypoxia
IDA biological_process
GO:0004392 heme oxygenase (decyclizi
ng) activity
IEA molecular_function
GO:0004392 heme oxygenase (decyclizi
ng) activity
IDA molecular_function
GO:0004392 heme oxygenase (decyclizi
ng) activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005783 endoplasmic reticulum
IEA cellular_component
GO:0005783 endoplasmic reticulum
IEA cellular_component
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0006788 heme oxidation
IEA biological_process
GO:0006879 cellular iron ion homeost
asis
TAS biological_process
GO:0016020 membrane
IDA cellular_component
GO:0016491 oxidoreductase activity
IEA molecular_function
GO:0042167 heme catabolic process
TAS biological_process
GO:0043231 intracellular membrane-bo
unded organelle
IEA cellular_component
GO:0043231 intracellular membrane-bo
unded organelle
IEA cellular_component
GO:0046872 metal ion binding
IEA molecular_function
GO:0055114 oxidation-reduction proce
ss
IEA biological_process
GO:0055114 oxidation-reduction proce
ss
IEA biological_process
GO:0001666 response to hypoxia
IDA biological_process
GO:0004392 heme oxygenase (decyclizi
ng) activity
IDA molecular_function
GO:0004392 heme oxygenase (decyclizi
ng) activity
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005789 endoplasmic reticulum mem
brane
TAS cellular_component
GO:0005886 plasma membrane
IDA cellular_component
GO:0006879 cellular iron ion homeost
asis
TAS biological_process
GO:0016020 membrane
IDA cellular_component
GO:0042167 heme catabolic process
TAS biological_process

KEGG pathways

hsa01100  Metabolic pathways
hsa04978  Mineral absorption
hsa00860  Porphyrin and chlorophyll metabolism

Diseases

Associated diseases References
Alzheimer's disease PMID: 19246912
Endometriosis PMID: 11872213
Peritoneal endometriosis PMID: 11872213
Peritoneal endometriosis PMID: 11872213
Preeclampsia PMID: 19399816
Peritoneal endometriosis INFBASE11872213

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
11872213 Endometrio
sis (Perit
oneal)

76 (Patients un
dergoing laparo
scopy for tubal
sterilization
or infertility
and/or pelvic p
ain)

Show abstract