Endometriosis Knowledgebase

Search Result

Gene id

3163

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HMOX2 Gene UCSC Ensembl

Aliases

HO-2

Gene name

heme oxygenase 2

Alternate names

heme oxygenase 2, heme oxygenase (decycling) 2,

Gene location

16p13.3 (4474696: 4510346) Exons: 12 NC_000016.10

Gene summary(Entrez)

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013]

OMIM

141251

Protein Summary

Protein general information

P30519

Name: Heme oxygenase 2 (HO 2) (EC 1.14.14.18)

Length: 316 Mass: 36,033

Sequence

MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLATTALY
FTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHYIGQNEPELLV
AHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANK
AFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGVALAAGLLAWYYM

Structural information

Interpro:	IPR002051 IPR016053 IPR016084 IPR018207
Prosite:	PS00593
Pfam:	PF01126
CDD:	cd00232
PDB:	2Q32 2QPP 2RGZ 4WMH 5UC8 5UC9 5UCA
PDBsum:	2Q32 2QPP 2RGZ 4WMH 5UC8 5UC9 5UCA
DIP:	53564
MINT:	1384587
STRING:	ENSP00000219700;

Other Databases

GeneCards: HMOX2; Malacards: HMOX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001666	response to hypoxia	IDA	biological_process
GO:0004392	heme oxygenase (decyclizi ng) activity	IDA	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006788	heme oxidation	IEA	biological_process
GO:0006879	cellular iron ion homeost asis	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0042167	heme catabolic process	TAS	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0001666	response to hypoxia	IDA	biological_process
GO:0004392	heme oxygenase (decyclizi ng) activity	IEA	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	IDA	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006788	heme oxidation	IEA	biological_process
GO:0006879	cellular iron ion homeost asis	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0042167	heme catabolic process	TAS	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0043231	intracellular membrane-bo unded organelle	IEA	cellular_component
GO:0046872	metal ion binding	IEA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0001666	response to hypoxia	IDA	biological_process
GO:0004392	heme oxygenase (decyclizi ng) activity	IDA	molecular_function
GO:0004392	heme oxygenase (decyclizi ng) activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005789	endoplasmic reticulum mem brane	TAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0006879	cellular iron ion homeost asis	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0042167	heme catabolic process	TAS	biological_process

KEGG pathways

hsa01100  Metabolic pathways
hsa04978  Mineral absorption
hsa00860  Porphyrin and chlorophyll metabolism

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19246912
Endometriosis	PMID: 11872213
Peritoneal endometriosis	PMID: 11872213
Peritoneal endometriosis	PMID: 11872213
Preeclampsia	PMID: 19399816
Peritoneal endometriosis	INFBASE11872213

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11872213	Endometrio sis (Perit oneal)			76 (Patients un dergoing laparo scopy for tubal sterilization or infertility and/or pelvic p ain)			Show abstract