Endometriosis Knowledgebase

Search Result

Gene id

3248

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HPGD Gene UCSC Ensembl

Aliases

15-PGDH, PGDH, PGDH1, PHOAR1, SDR36C1

Gene name

hydroxyprostaglandin dehydrogenase 15-(NAD)

Alternate names

15-hydroxyprostaglandin dehydrogenase [NAD(+)], NAD+-dependent 15-hydroxyprostaglandin dehydrogenase, prostaglandin dehydrogenase 1, short chain dehydrogenase/reductase family 36C member 1,

Gene location

4q34.1 (174522897: 174490176) Exons: 9 NC_000004.12

Gene summary(Entrez)

This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

OMIM

601688

Protein Summary

Protein general information

P15428

Name: 15 hydroxyprostaglandin dehydrogenase [NAD(+)] (15 PGDH) (EC 1.1.1.141) (Prostaglandin dehydrogenase 1) (Short chain dehydrogenase/reductase family 36C member 1)

Length: 266 Mass: 28,977

Tissue specificity: Detected in colon epithelium (at protein level). {ECO

Sequence

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTF
RKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPV
YCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLI
ANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQ

Structural information

Interpro:	IPR016040 IPR020904 IPR002347
Prosite:	PS00061
Pfam:	PF00106
PDB:	2GDZ
PDBsum:	2GDZ
STRING:	ENSP00000296522;

Other Databases

GeneCards: HPGD; Malacards: HPGD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003824	catalytic activity	IDA	molecular_function
GO:0004957	prostaglandin E receptor activity	IDA	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006693	prostaglandin metabolic p rocess	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007565	female pregnancy	IDA	biological_process
GO:0007567	parturition	IDA	biological_process
GO:0016323	basolateral plasma membra ne	IEA	cellular_component
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	NAS	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	TAS	molecular_function
GO:0019372	lipoxygenase pathway	TAS	biological_process
GO:0030728	ovulation	ISS	biological_process
GO:0042803	protein homodimerization activity	TAS	molecular_function
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0051287	NAD binding	IDA	molecular_function
GO:0051287	NAD binding	IDA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070403	NAD+ binding	IDA	molecular_function
GO:0070493	thrombin-activated recept or signaling pathway	ISS	biological_process
GO:0097070	ductus arteriosus closure	ISS	biological_process
GO:2001300	lipoxin metabolic process	TAS	biological_process
GO:0003824	catalytic activity	IDA	molecular_function
GO:0004957	prostaglandin E receptor activity	IDA	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006631	fatty acid metabolic proc ess	IEA	biological_process
GO:0006693	prostaglandin metabolic p rocess	IEA	biological_process
GO:0006693	prostaglandin metabolic p rocess	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007565	female pregnancy	IDA	biological_process
GO:0007567	parturition	IDA	biological_process
GO:0016323	basolateral plasma membra ne	IEA	cellular_component
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IEA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IEA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	NAS	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	TAS	molecular_function
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0016491	oxidoreductase activity	IEA	molecular_function
GO:0019372	lipoxygenase pathway	TAS	biological_process
GO:0030728	ovulation	ISS	biological_process
GO:0042803	protein homodimerization activity	TAS	molecular_function
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0051287	NAD binding	IDA	molecular_function
GO:0051287	NAD binding	IDA	molecular_function
GO:0055114	oxidation-reduction proce ss	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070403	NAD+ binding	IDA	molecular_function
GO:0070493	thrombin-activated recept or signaling pathway	IEA	biological_process
GO:0070493	thrombin-activated recept or signaling pathway	ISS	biological_process
GO:0097070	ductus arteriosus closure	IEA	biological_process
GO:0097070	ductus arteriosus closure	ISS	biological_process
GO:2001300	lipoxin metabolic process	TAS	biological_process
GO:0003824	catalytic activity	IDA	molecular_function
GO:0004957	prostaglandin E receptor activity	IDA	molecular_function
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006693	prostaglandin metabolic p rocess	IDA	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0007565	female pregnancy	IDA	biological_process
GO:0007567	parturition	IDA	biological_process
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	IDA	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	NAS	molecular_function
GO:0016404	15-hydroxyprostaglandin d ehydrogenase (NAD+) activ ity	TAS	molecular_function
GO:0019372	lipoxygenase pathway	TAS	biological_process
GO:0030728	ovulation	ISS	biological_process
GO:0042803	protein homodimerization activity	TAS	molecular_function
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0051287	NAD binding	IDA	molecular_function
GO:0051287	NAD binding	IDA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070403	NAD+ binding	IDA	molecular_function
GO:0070493	thrombin-activated recept or signaling pathway	ISS	biological_process
GO:0097070	ductus arteriosus closure	ISS	biological_process
GO:2001300	lipoxin metabolic process	TAS	biological_process

KEGG pathways

hsa05202 Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Amyotrophic lateral sclerosis (ALS)	PMID: 18987618
Endometriosis	PMID: 25446850
Hypertrophy	OMIM: 601688
Endometriosis	INFBASE25446850

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25446850	Endometrio sis			57 (29 patients with ovarian endometriosis, 28 control heal thy women)	Female infertility	PGF2A AKR1B1 AKR1C3 PLA2G2A PTGS2/COX-2 ABCC4 and PTGFR PLA2G4A and HPGD	Show abstract