Endometriosis Knowledgebase

Search Result

Gene id

3263

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HPX Gene UCSC Ensembl

Aliases

Gene name

hemopexin

Alternate names

hemopexin, beta-1B-glycoprotein,

Gene location

11p15.4 (6441023: 6431037) Exons: 10 NC_000011.10

Gene summary(Entrez)

This gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress. [provided by RefSeq, Apr 2009]

OMIM

142290

Protein Summary

Protein general information

P02790

Name: Hemopexin (Beta 1B glycoprotein)

Length: 462 Mass: 51,676

Tissue specificity: Expressed by the liver and secreted in plasma.

Sequence

MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFV
WKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECH
RGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVR
DYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQ
WPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIM
AGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQ
PQNVTSLLGCTH

Structural information

Interpro:	IPR016358 IPR000585 IPR018487 IPR018486
Prosite:	PS00024 PS51642
Pfam:	PF00045
CDD:	cd00094
DIP:	38339
STRING:	ENSP00000265983;

Other Databases

GeneCards: HPX; Malacards: HPX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002639	positive regulation of im munoglobulin production	IEA	biological_process
GO:0002925	positive regulation of hu moral immune response med iated by circulating immu noglobulin	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006879	cellular iron ion homeost asis	IEA	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0015232	heme transporter activity	IEA	molecular_function
GO:0015886	heme transport	IEA	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0020027	hemoglobin metabolic proc ess	IEA	biological_process
GO:0042168	heme metabolic process	IEA	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0060335	positive regulation of in terferon-gamma-mediated s ignaling pathway	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:0072562	blood microparticle	IDA	cellular_component
GO:0002639	positive regulation of im munoglobulin production	IEA	biological_process
GO:0002925	positive regulation of hu moral immune response med iated by circulating immu noglobulin	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006810	transport	IEA	biological_process
GO:0006879	cellular iron ion homeost asis	IEA	biological_process
GO:0006879	cellular iron ion homeost asis	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0015232	heme transporter activity	IEA	molecular_function
GO:0015232	heme transporter activity	TAS	molecular_function
GO:0015886	heme transport	IEA	biological_process
GO:0015886	heme transport	TAS	biological_process
GO:0016032	viral process	IEA	biological_process
GO:0020027	hemoglobin metabolic proc ess	IEA	biological_process
GO:0042168	heme metabolic process	IEA	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051246	regulation of protein met abolic process	IEA	biological_process
GO:0060332	positive regulation of re sponse to interferon-gamm a	IEA	biological_process
GO:0060335	positive regulation of in terferon-gamma-mediated s ignaling pathway	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:0072562	blood microparticle	IDA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006879	cellular iron ion homeost asis	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0015232	heme transporter activity	TAS	molecular_function
GO:0015886	heme transport	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:0072562	blood microparticle	IDA	cellular_component

Diseases

Associated diseases	References
Endometriosis	PMID: 23755951
Endometriosis	INFBASE23755951

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
23755951	Endometrio sis			80 symptomatic patients schedu led for laparos copy for the di agnosis and/or therapy of endo metriosis	Female infertility		Show abstract