Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 3297
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol HSF1   Gene   UCSC   Ensembl
Aliases HSTF1
Gene name heat shock transcription factor 1
Alternate names heat shock factor protein 1,
Gene location 8q24.3 (144291587: 144314721)     Exons: 14     NC_000008.11
Gene summary(Entrez) The product of this gene is a transcription factor that is rapidly induced after temperature stress and binds heat shock promoter elements (HSE). This protein plays a role in the regulation of lifespan. Expression of this gene is repressed by phsphorylation, which promotes binding by heat shock protein 90. [provided by RefSeq, Aug 2016]
OMIM 140580

Protein Summary

Protein general information Q00613  

Name: Heat shock factor protein 1 (HSF 1) (Heat shock transcription factor 1) (HSTF 1)

Length: 529  Mass: 57,260

Sequence MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNM
YGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGK
QECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKY
SRQFSLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEE
PPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLS
VACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPR
PPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKD
PTVS
Structural information

Motifs
9aaTAD. {ECO:0000303|PubMed:17467953}.(412-420)
Interpro:  IPR027072 IPR000232 IPR027725 IPR010542 IPR011991
Prosite:   PS00434

Pfam:  
PF00447 PF06546

PDB:  
2LDU 5D5U 5D5V 5HDG 5HDN
PDBsum:   2LDU 5D5U 5D5V 5HDG 5HDN

DIP:  
35670
MINT:   230849
STRING:   ENSP00000431512;
Other Databases GeneCards:  HSF1;  Malacards:  HSF1

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0000978 RNA polymerase II core pr
omoter proximal region se
quence-specific DNA bindi
ng
IDA molecular_function
GO:0000979 RNA polymerase II core pr
omoter sequence-specific
DNA binding
IEA molecular_function
GO:0001078 transcriptional repressor
activity, RNA polymerase
II core promoter proxima
l region sequence-specifi
c binding
IDA molecular_function
GO:0001162 RNA polymerase II introni
c transcription regulator
y region sequence-specifi
c DNA binding
IDA molecular_function
GO:0001892 embryonic placenta develo
pment
IEA biological_process
GO:0003682 chromatin binding
IEA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
TAS molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005654 nucleoplasm
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006468 protein phosphorylation
IEA biological_process
GO:0006952 defense response
IEA biological_process
GO:0007143 female meiotic division
IEA biological_process
GO:0007283 spermatogenesis
IEA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IEA biological_process
GO:0009299 mRNA transcription
IDA biological_process
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0032720 negative regulation of tu
mor necrosis factor produ
ction
IEA biological_process
GO:0034605 cellular response to heat
IDA biological_process
GO:0040018 positive regulation of mu
lticellular organism grow
th
IEA biological_process
GO:0043234 protein complex
IEA cellular_component
GO:0045120 pronucleus
IEA cellular_component
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0060136 embryonic process involve
d in female pregnancy
IEA biological_process
GO:1900034 regulation of cellular re
sponse to heat
TAS biological_process
GO:1900034 regulation of cellular re
sponse to heat
TAS biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0000978 RNA polymerase II core pr
omoter proximal region se
quence-specific DNA bindi
ng
IDA molecular_function
GO:0000979 RNA polymerase II core pr
omoter sequence-specific
DNA binding
IEA molecular_function
GO:0001078 transcriptional repressor
activity, RNA polymerase
II core promoter proxima
l region sequence-specifi
c binding
IDA molecular_function
GO:0001162 RNA polymerase II introni
c transcription regulator
y region sequence-specifi
c DNA binding
IDA molecular_function
GO:0001701 in utero embryonic develo
pment
IEA biological_process
GO:0001892 embryonic placenta develo
pment
IEA biological_process
GO:0003677 DNA binding
IEA molecular_function
GO:0003677 DNA binding
IEA molecular_function
GO:0003677 DNA binding
IEA molecular_function
GO:0003682 chromatin binding
IEA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
IEA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
TAS molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005634 nucleus
IEA cellular_component
GO:0005654 nucleoplasm
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0006351 transcription, DNA-templa
ted
IEA biological_process
GO:0006351 transcription, DNA-templa
ted
IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological_process
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological_process
GO:0006468 protein phosphorylation
IEA biological_process
GO:0006952 defense response
IEA biological_process
GO:0007143 female meiotic division
IEA biological_process
GO:0007283 spermatogenesis
IEA biological_process
GO:0008285 negative regulation of ce
ll proliferation
IEA biological_process
GO:0009299 mRNA transcription
IDA biological_process
GO:0009408 response to heat
IEA biological_process
GO:0009408 response to heat
IEA biological_process
GO:0032496 response to lipopolysacch
aride
IEA biological_process
GO:0032720 negative regulation of tu
mor necrosis factor produ
ction
IEA biological_process
GO:0034605 cellular response to heat
IDA biological_process
GO:0040018 positive regulation of mu
lticellular organism grow
th
IEA biological_process
GO:0043234 protein complex
IEA cellular_component
GO:0043565 sequence-specific DNA bin
ding
IEA molecular_function
GO:0043565 sequence-specific DNA bin
ding
IEA molecular_function
GO:0045120 pronucleus
IEA cellular_component
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0060136 embryonic process involve
d in female pregnancy
IEA biological_process
GO:1900034 regulation of cellular re
sponse to heat
TAS biological_process
GO:1900034 regulation of cellular re
sponse to heat
TAS biological_process
GO:0000122 negative regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:0000978 RNA polymerase II core pr
omoter proximal region se
quence-specific DNA bindi
ng
IDA molecular_function
GO:0001078 transcriptional repressor
activity, RNA polymerase
II core promoter proxima
l region sequence-specifi
c binding
IDA molecular_function
GO:0001162 RNA polymerase II introni
c transcription regulator
y region sequence-specifi
c DNA binding
IDA molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
TAS molecular_function
GO:0003700 transcription factor acti
vity, sequence-specific D
NA binding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005654 nucleoplasm
IDA cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005654 nucleoplasm
TAS cellular_component
GO:0005737 cytoplasm
IDA cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0005829 cytosol
TAS cellular_component
GO:0009299 mRNA transcription
IDA biological_process
GO:0034605 cellular response to heat
IDA biological_process
GO:0045944 positive regulation of tr
anscription from RNA poly
merase II promoter
IDA biological_process
GO:1900034 regulation of cellular re
sponse to heat
TAS biological_process
GO:1900034 regulation of cellular re
sponse to heat
TAS biological_process

KEGG pathways

hsa05134  Legionellosis

Diseases

Associated diseases References
Cancer PMID: 10702402
Endometriosis PMID: 20199104
Oligozoospermia PMID: 20096881
Endometriosis INFBASE20199104

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
20199104 Endometrio
sis


Female infertility PRDX6
CORO1A
TAGLN2
VIM
CFTR
GCR
HSF1
Show abstract