Endometriosis Knowledgebase

Search Result

Gene id

3315

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HSPB1 Gene UCSC Ensembl

Aliases

CMT2F, HEL-S-102, HMN2B, HS.76067, HSP27, HSP28, Hsp25, SRP27

Gene name

heat shock protein family B (small) member 1

Alternate names

heat shock protein beta-1, 28 kDa heat shock protein, epididymis secretory protein Li 102, estrogen-regulated 24 kDa protein, heat shock 27 kDa protein, heat shock 27kD protein 1, heat shock 27kDa protein 1, stress-responsive protein 27,

Gene location

7q11.23 (76302557: 76304296) Exons: 3 NC_000007.14

Gene summary(Entrez)

The protein encoded by this gene is induced by environmental stress and developmental changes. The encoded protein is involved in stress resistance and actin organization and translocates from the cytoplasm to the nucleus upon stress induction. Defects in this gene are a cause of Charcot-Marie-Tooth disease type 2F (CMT2F) and distal hereditary motor neuropathy (dHMN). [provided by RefSeq, Oct 2008]

OMIM

602195

Protein Summary

Protein general information

P04792

Name: Heat shock protein beta 1 (HspB1) (28 kDa heat shock protein) (Estrogen regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Stress responsive protein 27) (SRP27)

Length: 205 Mass: 22,783

Tissue specificity: Detected in all tissues tested

Sequence

MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSR
ALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDP
TQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Structural information

Protein Domains	sHSP. (76-184)
Interpro:	IPR002068 IPR001436 IPR031107 IPR008978
Prosite:	PS01031
Pfam:	PF00011
PDB:	2N3J 3Q9P 3Q9Q 4MJH
PDBsum:	2N3J 3Q9P 3Q9Q 4MJH
DIP:	412
MINT:	1368692
STRING:	ENSP00000248553;

Other Databases

GeneCards: HSPB1; Malacards: HSPB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000502	proteasome complex	ISS	cellular_component
GO:0001895	retina homeostasis	IEP	biological_process
GO:0005080	protein kinase C binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005819	spindle	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006446	regulation of translation al initiation	TAS	biological_process
GO:0006469	negative regulation of pr otein kinase activity	ISS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006986	response to unfolded prot ein	NAS	biological_process
GO:0008426	protein kinase C inhibito r activity	ISS	molecular_function
GO:0009615	response to virus	IEP	biological_process
GO:0010506	regulation of autophagy	NAS	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030018	Z disc	IEA	cellular_component
GO:0032731	positive regulation of in terleukin-1 beta producti on	ISS	biological_process
GO:0035556	intracellular signal tran sduction	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0038033	positive regulation of en dothelial cell chemotaxis by VEGF-activated vascul ar endothelial growth fac tor receptor signaling pa thway	IMP	biological_process
GO:0042535	positive regulation of tu mor necrosis factor biosy nthetic process	ISS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	ISS	biological_process
GO:0043130	ubiquitin binding	ISS	molecular_function
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IMP	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070527	platelet aggregation	IMP	biological_process
GO:0071901	negative regulation of pr otein serine/threonine ki nase activity	IEA	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	ISS	biological_process
GO:2001028	positive regulation of en dothelial cell chemotaxis	IMP	biological_process
GO:0000502	proteasome complex	IEA	cellular_component
GO:0000502	proteasome complex	ISS	cellular_component
GO:0001895	retina homeostasis	IEP	biological_process
GO:0005080	protein kinase C binding	IEA	molecular_function
GO:0005080	protein kinase C binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005819	spindle	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	IEA	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006446	regulation of translation al initiation	TAS	biological_process
GO:0006469	negative regulation of pr otein kinase activity	IEA	biological_process
GO:0006469	negative regulation of pr otein kinase activity	ISS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006986	response to unfolded prot ein	TAS	biological_process
GO:0006986	response to unfolded prot ein	NAS	biological_process
GO:0008426	protein kinase C inhibito r activity	IEA	molecular_function
GO:0008426	protein kinase C inhibito r activity	ISS	molecular_function
GO:0009615	response to virus	IEP	biological_process
GO:0010506	regulation of autophagy	NAS	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030018	Z disc	IEA	cellular_component
GO:0032731	positive regulation of in terleukin-1 beta producti on	IEA	biological_process
GO:0032731	positive regulation of in terleukin-1 beta producti on	ISS	biological_process
GO:0035556	intracellular signal tran sduction	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0038033	positive regulation of en dothelial cell chemotaxis by VEGF-activated vascul ar endothelial growth fac tor receptor signaling pa thway	IMP	biological_process
GO:0042535	positive regulation of tu mor necrosis factor biosy nthetic process	IEA	biological_process
GO:0042535	positive regulation of tu mor necrosis factor biosy nthetic process	ISS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	IEA	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	ISS	biological_process
GO:0043130	ubiquitin binding	IEA	molecular_function
GO:0043130	ubiquitin binding	ISS	molecular_function
GO:0043292	contractile fiber	IEA	cellular_component
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IMP	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070527	platelet aggregation	IMP	biological_process
GO:0071901	negative regulation of pr otein serine/threonine ki nase activity	IEA	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	IEA	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	ISS	biological_process
GO:2001028	positive regulation of en dothelial cell chemotaxis	IMP	biological_process
GO:2001234	negative regulation of ap optotic signaling pathway	IEA	biological_process
GO:0000502	proteasome complex	ISS	cellular_component
GO:0001895	retina homeostasis	IEP	biological_process
GO:0005080	protein kinase C binding	ISS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005856	cytoskeleton	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006446	regulation of translation al initiation	TAS	biological_process
GO:0006469	negative regulation of pr otein kinase activity	ISS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006986	response to unfolded prot ein	TAS	biological_process
GO:0006986	response to unfolded prot ein	NAS	biological_process
GO:0008426	protein kinase C inhibito r activity	ISS	molecular_function
GO:0009615	response to virus	IEP	biological_process
GO:0010506	regulation of autophagy	NAS	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0032731	positive regulation of in terleukin-1 beta producti on	ISS	biological_process
GO:0035556	intracellular signal tran sduction	IMP	biological_process
GO:0035924	cellular response to vasc ular endothelial growth f actor stimulus	IMP	biological_process
GO:0038033	positive regulation of en dothelial cell chemotaxis by VEGF-activated vascul ar endothelial growth fac tor receptor signaling pa thway	IMP	biological_process
GO:0042535	positive regulation of tu mor necrosis factor biosy nthetic process	ISS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	ISS	biological_process
GO:0043130	ubiquitin binding	ISS	molecular_function
GO:0043488	regulation of mRNA stabil ity	TAS	biological_process
GO:0043536	positive regulation of bl ood vessel endothelial ce ll migration	IMP	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045766	positive regulation of an giogenesis	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070527	platelet aggregation	IMP	biological_process
GO:1902176	negative regulation of ox idative stress-induced in trinsic apoptotic signali ng pathway	ISS	biological_process
GO:2001028	positive regulation of en dothelial cell chemotaxis	IMP	biological_process

KEGG pathways

hsa04010  MAPK signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05146  Amoebiasis
hsa04370  VEGF signaling pathway

Diseases

Associated diseases	References
Abnormal spermatogenesis	PMID: 18692580
Azoospermia	PMID: 18068167
Charcot-Marie-Tooth disease	OMIM: 602195
Distal hereditary motor neuropathies	KEGG: H00856
Endometriosis	PMID: 9207579
Gonad development	PMID: 15120973
Multiple sclerosis	PMID: 21654844
Neuropathy	OMIM: 602195
Polycystic ovary syndrome (PCOS)	PMID: 23382852
Endometriosis	INFBASE9207579
Semen quality	PMID: 26209830
Spermatogenetic defects	PMID: 26209830

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
9207579	Endometrio sis			119 women with endometriosis o r adenomyosis ( 38 fertile cont rol, 38 endomet riosis, 43 aden omyosis, 33 who underwent hyst erectomy, 10 tr eated with dana zol )		HSP27 HSP70	Show abstract