Endometriosis Knowledgebase

Search Result

Gene id

3320

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

HSP90AA1 Gene UCSC Ensembl

Aliases

EL52, HEL-S-65p, HSP86, HSP89A, HSP90A, HSP90N, HSPC1, HSPCA, HSPCAL1, HSPCAL4, HSPN, Hsp103, Hsp89, Hsp90, LAP-2, LAP2

Gene name

heat shock protein 90 alpha family class A member 1

Alternate names

heat shock protein HSP 90-alpha, HSP 86, LPS-associated protein 2, epididymis luminal secretory protein 52, epididymis secretory sperm binding protein Li 65p, heat shock 86 kDa, heat shock 90kD protein 1, alpha, heat shock 90kD protein 1, alpha-like 4, heat shock,

Gene location

14q32.31 (102139748: 102080737) Exons: 13 NC_000014.9

Gene summary(Entrez)

The protein encoded by this gene is an inducible molecular chaperone that functions as a homodimer. The encoded protein aids in the proper folding of specific target proteins by use of an ATPase activity that is modulated by co-chaperones. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]

OMIM

140571

Protein Summary

Protein general information

P07900

Name: Heat shock protein HSP 90 alpha (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide associated protein 2) (LAP 2) (LPS associated protein 2) (Renal carcinoma antigen NY REN 38)

Length: 732 Mass: 84,660

Sequence

MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKE
LHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTV
ITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKE
RDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCE
ELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIH
EDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPI
DEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSG
FSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD

Structural information

Motifs	TPR repeat-binding.(723-732)
Interpro:	IPR003594 IPR019805 IPR001404 IPR020575 IPR020568
Prosite:	PS00298
Pfam:	PF02518 PF00183
PDB:	1BYQ 1OSF 1UY6 1UY7 1UY8 1UY9 1UYC 1UYD 1UYE 1UYF 1UYG 1UYH 1UYI 1UYK 1UYL 1YC1 1YC3 1YC4 1YER 1YES 1YET 2BSM 2BT0 2BUG 2BYH 2BYI 2BZ5 2C2L 2CCS 2CCT 2CCU 2FWY 2FWZ 2H55 2JJC 2K5B 2QF6 2QFO 2QG0 2QG2 2UWD 2VCI 2VCJ 2WI1 2WI2 2WI3 2WI4 2WI5 2WI6 2WI7 2XAB
PDBsum:	1BYQ 1OSF 1UY6 1UY7 1UY8 1UY9 1UYC 1UYD 1UYE 1UYF 1UYG 1UYH 1UYI 1UYK 1UYL 1YC1 1YC3 1YC4 1YER 1YES 1YET 2BSM 2BT0 2BUG 2BYH 2BYI 2BZ5 2C2L 2CCS 2CCT 2CCU 2FWY 2FWZ 2H55 2JJC 2K5B 2QF6 2QFO 2QG0 2QG2 2UWD 2VCI 2VCJ 2WI1 2WI2 2WI3 2WI4 2WI5 2WI6 2WI7 2XAB
DIP:	27595
MINT:	132070
STRING:	ENSP00000335153;

Other Databases

GeneCards: HSP90AA1; Malacards: HSP90AA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000086	G2/M transition of mitoti c cell cycle	TAS	biological_process
GO:0000166	nucleotide binding	TAS	molecular_function
GO:0001764	neuron migration	IEA	biological_process
GO:0002134	UTP binding	IEA	molecular_function
GO:0002135	CTP binding	IEA	molecular_function
GO:0003009	skeletal muscle contracti on	IEA	biological_process
GO:0003729	mRNA binding	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	TAS	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006839	mitochondrial transport	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006986	response to unfolded prot ein	NAS	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0009408	response to heat	ISS	biological_process
GO:0009409	response to cold	ISS	biological_process
GO:0009651	response to salt stress	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010592	positive regulation of la mellipodium assembly	IEA	biological_process
GO:0010659	cardiac muscle cell apopt otic process	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016323	basolateral plasma membra ne	IEA	cellular_component
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016887	ATPase activity	IDA	molecular_function
GO:0017098	sulfonylurea receptor bin ding	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019903	protein phosphatase bindi ng	IEA	molecular_function
GO:0023026	MHC class II protein comp lex binding	IDA	molecular_function
GO:0030235	nitric-oxide synthase reg ulator activity	IDA	molecular_function
GO:0030911	TPR domain binding	TAS	molecular_function
GO:0030911	TPR domain binding	IDA	molecular_function
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0031396	regulation of protein ubi quitination	IDA	biological_process
GO:0031526	brush border membrane	IEA	cellular_component
GO:0032564	dATP binding	IEA	molecular_function
GO:0032587	ruffle membrane	IEA	cellular_component
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IEA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042026	protein refolding	TAS	biological_process
GO:0042470	melanosome	IEA	cellular_component
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	TAS	molecular_function
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043005	neuron projection	IEA	cellular_component
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043209	myelin sheath	IEA	cellular_component
GO:0043234	protein complex	IEA	cellular_component
GO:0043254	regulation of protein com plex assembly	NAS	biological_process
GO:0043335	protein unfolding	NAS	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0044325	ion channel binding	IEA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045040	protein import into mitoc hondrial outer membrane	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	ISS	biological_process
GO:0045793	positive regulation of ce ll size	IEA	biological_process
GO:0046677	response to antibiotic	ISS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050821	protein stabilization	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0051020	GTPase binding	IPI	molecular_function
GO:0051022	Rho GDP-dissociation inhi bitor binding	IEA	molecular_function
GO:0051082	unfolded protein binding	IEA	molecular_function
GO:0051131	chaperone-mediated protei n complex assembly	IDA	biological_process
GO:0060452	positive regulation of ca rdiac muscle contraction	IEA	biological_process
GO:0061684	chaperone-mediated autoph agy	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	TAS	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0000166	nucleotide binding	TAS	molecular_function
GO:0001764	neuron migration	IEA	biological_process
GO:0002134	UTP binding	IEA	molecular_function
GO:0002135	CTP binding	IEA	molecular_function
GO:0003009	skeletal muscle contracti on	IEA	biological_process
GO:0003729	mRNA binding	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	TAS	molecular_function
GO:0005525	GTP binding	IEA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006457	protein folding	IEA	biological_process
GO:0006839	mitochondrial transport	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006950	response to stress	IEA	biological_process
GO:0006986	response to unfolded prot ein	NAS	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0009408	response to heat	ISS	biological_process
GO:0009409	response to cold	ISS	biological_process
GO:0009651	response to salt stress	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010592	positive regulation of la mellipodium assembly	IEA	biological_process
GO:0010659	cardiac muscle cell apopt otic process	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016323	basolateral plasma membra ne	IEA	cellular_component
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016887	ATPase activity	IDA	molecular_function
GO:0017098	sulfonylurea receptor bin ding	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019903	protein phosphatase bindi ng	IEA	molecular_function
GO:0023026	MHC class II protein comp lex binding	IDA	molecular_function
GO:0030235	nitric-oxide synthase reg ulator activity	IEA	molecular_function
GO:0030235	nitric-oxide synthase reg ulator activity	IDA	molecular_function
GO:0030911	TPR domain binding	TAS	molecular_function
GO:0030911	TPR domain binding	IDA	molecular_function
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0031396	regulation of protein ubi quitination	IDA	biological_process
GO:0031526	brush border membrane	IEA	cellular_component
GO:0032564	dATP binding	IEA	molecular_function
GO:0032587	ruffle membrane	IEA	cellular_component
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IEA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042026	protein refolding	TAS	biological_process
GO:0042470	melanosome	IEA	cellular_component
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	IEA	molecular_function
GO:0042803	protein homodimerization activity	TAS	molecular_function
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043005	neuron projection	IEA	cellular_component
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043209	myelin sheath	IEA	cellular_component
GO:0043234	protein complex	IEA	cellular_component
GO:0043254	regulation of protein com plex assembly	NAS	biological_process
GO:0043335	protein unfolding	NAS	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0044325	ion channel binding	IEA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045040	protein import into mitoc hondrial outer membrane	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	ISS	biological_process
GO:0045793	positive regulation of ce ll size	IEA	biological_process
GO:0046677	response to antibiotic	ISS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0050790	regulation of catalytic a ctivity	IEA	biological_process
GO:0050821	protein stabilization	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0051020	GTPase binding	IPI	molecular_function
GO:0051022	Rho GDP-dissociation inhi bitor binding	IEA	molecular_function
GO:0051082	unfolded protein binding	IEA	molecular_function
GO:0051131	chaperone-mediated protei n complex assembly	IDA	biological_process
GO:0060452	positive regulation of ca rdiac muscle contraction	IEA	biological_process
GO:0061684	chaperone-mediated autoph agy	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process
GO:0000086	G2/M transition of mitoti c cell cycle	TAS	biological_process
GO:0000166	nucleotide binding	TAS	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	EXP	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005524	ATP binding	TAS	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005634	nucleus	ISS	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005737	cytoplasm	ISS	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005829	cytosol	NAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006839	mitochondrial transport	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006986	response to unfolded prot ein	NAS	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0009408	response to heat	ISS	biological_process
GO:0009409	response to cold	ISS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0016887	ATPase activity	IDA	molecular_function
GO:0023026	MHC class II protein comp lex binding	IDA	molecular_function
GO:0030235	nitric-oxide synthase reg ulator activity	IDA	molecular_function
GO:0030911	TPR domain binding	TAS	molecular_function
GO:0030911	TPR domain binding	IDA	molecular_function
GO:0031396	regulation of protein ubi quitination	IDA	biological_process
GO:0038096	Fc-gamma receptor signali ng pathway involved in ph agocytosis	TAS	biological_process
GO:0038128	ERBB2 signaling pathway	TAS	biological_process
GO:0042026	protein refolding	TAS	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042803	protein homodimerization activity	TAS	molecular_function
GO:0042826	histone deacetylase bindi ng	IPI	molecular_function
GO:0043202	lysosomal lumen	TAS	cellular_component
GO:0043254	regulation of protein com plex assembly	NAS	biological_process
GO:0043335	protein unfolding	NAS	biological_process
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0044822	poly(A) RNA binding	IDA	molecular_function
GO:0045040	protein import into mitoc hondrial outer membrane	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	ISS	biological_process
GO:0046677	response to antibiotic	ISS	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050821	protein stabilization	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	TAS	biological_process
GO:0051020	GTPase binding	IPI	molecular_function
GO:0051131	chaperone-mediated protei n complex assembly	IDA	biological_process
GO:0061684	chaperone-mediated autoph agy	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:1900034	regulation of cellular re sponse to heat	TAS	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05418  Fluid shear stress and atherosclerosis
hsa04621  NOD-like receptor signaling pathway
hsa04659  Th17 cell differentiation
hsa05215  Prostate cancer
hsa04657  IL-17 signaling pathway
hsa04915  Estrogen signaling pathway
hsa04217  Necroptosis
hsa04612  Antigen processing and presentation
hsa04914  Progesterone-mediated oocyte maturation
hsa04141  Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Endometriosis (ovarian)	PMID: 16815388
Asthma	PMID: 19254810
Oligozoospermia	PMID: 20096881
Ovarian endometriosis	PMID: 16815388
Ovarian endometriosis	INFBASE16815388
Varicocele	PMID: 23540861
Varicocele	PMID: 15992426

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16815388	Endometrio sis (ovari an)					PDGFRA PKCbeta1 JAK1 HSP90A COUP-TF2 MOR 17betaHSD2 Sprouty2 and PGE(2)EP3	Show abstract