Endometriosis Knowledgebase

Search Result

Gene id

335

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

APOA1 Gene UCSC Ensembl

Aliases

apo(a)

Gene name

apolipoprotein A1

Alternate names

apolipoprotein A-I, apo-AI,

Gene location

11q23.3 (116837949: 116835750) Exons: 5 NC_000011.10

Gene summary(Entrez)

This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The encoded preproprotein is proteolytically processed to generate the mature protein, which promotes cholesterol efflux from tissues to the liver for excretion, and is a cofactor for lecithin cholesterolacyltransferase (LCAT), an enzyme responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein. [provided by RefSeq, Dec 2015]

OMIM

107680

SNPs

rs1250248

Strand: +   Allele origin: unknown  Allele change: A/G   Mutation type: snp


NC_000002.12   g.215422370A>G
NC_000002.11   g.216287093A>G
NG_012196.1   g.18699T>C
NM_001306132.1   c.1394-127T>C
NM_001306131.1   c.1394-127T>C
NM_001306129.1   c.1394-127T>C
NM_001306130.1   c.1394-127T>C
NM_002026.3   c.1394-127T>C
NM_054034.2   c.1394-127T>C
NM_2124

Protein Summary

Protein general information

P02647

Name: Apolipoprotein A I (Apo AI) (ApoA I) (Apolipoprotein A1) [Cleaved into: Proapolipoprotein A I (ProapoA I); Truncated apolipoprotein A I (Apolipoprotein A I(1 242))]

Length: 267 Mass: 30,778

Tissue specificity: Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in car

Sequence

MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWD
SVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAEL
QEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLS
TLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Structural information

Interpro:	IPR000074
Pfam:	PF01442
PDB:	1AV1 1GW3 1GW4 1ODP 1ODQ 1ODR 2A01 2MSC 2MSD 2MSE 2N5E 3K2S 3R2P 4V6M
PDBsum:	1AV1 1GW3 1GW4 1ODP 1ODQ 1ODR 2A01 2MSC 2MSD 2MSE 2N5E 3K2S 3R2P 4V6M
DIP:	29619
MINT:	5000866
STRING:	ENSP00000236850;

Other Databases

GeneCards: APOA1; Malacards: APOA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0001540	beta-amyloid binding	IDA	molecular_function
GO:0001932	regulation of protein pho sphorylation	IEA	biological_process
GO:0001935	endothelial cell prolifer ation	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005543	phospholipid binding	IDA	molecular_function
GO:0005548	phospholipid transporter activity	IEA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006656	phosphatidylcholine biosy nthetic process	IDA	biological_process
GO:0006695	cholesterol biosynthetic process	IBA	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IDA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0008035	high-density lipoprotein particle binding	IEA	molecular_function
GO:0008203	cholesterol metabolic pro cess	IMP	biological_process
GO:0008211	glucocorticoid metabolic process	IEA	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0010804	negative regulation of tu mor necrosis factor-media ted signaling pathway	IDA	biological_process
GO:0010873	positive regulation of ch olesterol esterification	IDA	biological_process
GO:0010898	positive regulation of tr iglyceride catabolic proc ess	IBA	biological_process
GO:0010903	negative regulation of ve ry-low-density lipoprotei n particle remodeling	IDA	biological_process
GO:0014012	peripheral nervous system axon regeneration	IEA	biological_process
GO:0015485	cholesterol binding	IDA	molecular_function
GO:0017127	cholesterol transporter a ctivity	IMP	molecular_function
GO:0018158	protein oxidation	IDA	biological_process
GO:0018206	peptidyl-methionine modif ication	IDA	biological_process
GO:0019433	triglyceride catabolic pr ocess	IBA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019915	lipid storage	IEA	biological_process
GO:0030139	endocytic vesicle	IDA	cellular_component
GO:0030300	regulation of intestinal cholesterol absorption	IBA	biological_process
GO:0030301	cholesterol transport	IDA	biological_process
GO:0030325	adrenal gland development	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031102	neuron projection regener ation	IBA	biological_process
GO:0031210	phosphatidylcholine bindi ng	IBA	molecular_function
GO:0031410	cytoplasmic vesicle	IDA	cellular_component
GO:0032489	regulation of Cdc42 prote in signal transduction	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IMP	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033700	phospholipid efflux	IDA	biological_process
GO:0033700	phospholipid efflux	IDA	biological_process
GO:0034115	negative regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0034190	apolipoprotein receptor b inding	IPI	molecular_function
GO:0034191	apolipoprotein A-I recept or binding	IPI	molecular_function
GO:0034361	very-low-density lipoprot ein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034365	discoidal high-density li poprotein particle	IEA	cellular_component
GO:0034366	spherical high-density li poprotein particle	IDA	cellular_component
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	IC	biological_process
GO:0034380	high-density lipoprotein particle assembly	IDA	biological_process
GO:0034384	high-density lipoprotein particle clearance	IC	biological_process
GO:0034774	secretory granule lumen	TAS	cellular_component
GO:0035025	positive regulation of Rh o protein signal transduc tion	IDA	biological_process
GO:0042157	lipoprotein metabolic pro cess	IBA	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042627	chylomicron	IBA	cellular_component
GO:0042632	cholesterol homeostasis	IMP	biological_process
GO:0042632	cholesterol homeostasis	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043534	blood vessel endothelial cell migration	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0043691	reverse cholesterol trans port	IMP	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045499	chemorepellent activity	IDA	molecular_function
GO:0045723	positive regulation of fa tty acid biosynthetic pro cess	IBA	biological_process
GO:0050713	negative regulation of in terleukin-1 beta secretio n	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	IDA	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0050919	negative chemotaxis	IDA	biological_process
GO:0051006	positive regulation of li poprotein lipase activity	IBA	biological_process
GO:0051180	vitamin transport	IMP	biological_process
GO:0051345	positive regulation of hy drolase activity	IDA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IDA	biological_process
GO:0055085	transmembrane transport	TAS	biological_process
GO:0055091	phospholipid homeostasis	IDA	biological_process
GO:0055102	lipase inhibitor activity	IEA	molecular_function
GO:0060192	negative regulation of li pase activity	IEA	biological_process
GO:0060228	phosphatidylcholine-stero l O-acyltransferase activ ator activity	IDA	molecular_function
GO:0060354	negative regulation of ce ll adhesion molecule prod uction	IDA	biological_process
GO:0060761	negative regulation of re sponse to cytokine stimul us	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070328	triglyceride homeostasis	IDA	biological_process
GO:0070508	cholesterol import	IMP	biological_process
GO:0070653	high-density lipoprotein particle receptor binding	IPI	molecular_function
GO:0070653	high-density lipoprotein particle receptor binding	IPI	molecular_function
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:0072562	blood microparticle	IDA	cellular_component
GO:1900026	positive regulation of su bstrate adhesion-dependen t cell spreading	IDA	biological_process
GO:1903561	extracellular vesicle	IDA	cellular_component
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0070371	ERK1 and ERK2 cascade	IDA	biological_process
GO:0017127	cholesterol transporter a ctivity	IDA	molecular_function
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0001540	beta-amyloid binding	IDA	molecular_function
GO:0001932	regulation of protein pho sphorylation	IEA	biological_process
GO:0001935	endothelial cell prolifer ation	IEA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0005319	lipid transporter activit y	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005543	phospholipid binding	IDA	molecular_function
GO:0005548	phospholipid transporter activity	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006629	lipid metabolic process	IEA	biological_process
GO:0006644	phospholipid metabolic pr ocess	IEA	biological_process
GO:0006656	phosphatidylcholine biosy nthetic process	IDA	biological_process
GO:0006695	cholesterol biosynthetic process	IEA	biological_process
GO:0006695	cholesterol biosynthetic process	IBA	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006869	lipid transport	IEA	biological_process
GO:0006869	lipid transport	IEA	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IDA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0008035	high-density lipoprotein particle binding	IEA	molecular_function
GO:0008202	steroid metabolic process	IEA	biological_process
GO:0008203	cholesterol metabolic pro cess	IEA	biological_process
GO:0008203	cholesterol metabolic pro cess	IEA	biological_process
GO:0008203	cholesterol metabolic pro cess	IMP	biological_process
GO:0008211	glucocorticoid metabolic process	IEA	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0008289	lipid binding	IEA	molecular_function
GO:0009986	cell surface	IEA	cellular_component
GO:0010804	negative regulation of tu mor necrosis factor-media ted signaling pathway	IDA	biological_process
GO:0010873	positive regulation of ch olesterol esterification	IDA	biological_process
GO:0010898	positive regulation of tr iglyceride catabolic proc ess	IBA	biological_process
GO:0010903	negative regulation of ve ry-low-density lipoprotei n particle remodeling	IDA	biological_process
GO:0014012	peripheral nervous system axon regeneration	IEA	biological_process
GO:0015485	cholesterol binding	IDA	molecular_function
GO:0015914	phospholipid transport	IEA	biological_process
GO:0017127	cholesterol transporter a ctivity	IEA	molecular_function
GO:0017127	cholesterol transporter a ctivity	IMP	molecular_function
GO:0018158	protein oxidation	IDA	biological_process
GO:0018206	peptidyl-methionine modif ication	IDA	biological_process
GO:0019433	triglyceride catabolic pr ocess	IBA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0019915	lipid storage	IEA	biological_process
GO:0030139	endocytic vesicle	IDA	cellular_component
GO:0030300	regulation of intestinal cholesterol absorption	IEA	biological_process
GO:0030300	regulation of intestinal cholesterol absorption	IBA	biological_process
GO:0030301	cholesterol transport	IEA	biological_process
GO:0030301	cholesterol transport	IDA	biological_process
GO:0030325	adrenal gland development	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031102	neuron projection regener ation	IBA	biological_process
GO:0031210	phosphatidylcholine bindi ng	IBA	molecular_function
GO:0031410	cytoplasmic vesicle	IDA	cellular_component
GO:0032489	regulation of Cdc42 prote in signal transduction	IDA	biological_process
GO:0033344	cholesterol efflux	IEA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IMP	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033700	phospholipid efflux	IDA	biological_process
GO:0033700	phospholipid efflux	IDA	biological_process
GO:0034115	negative regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0034190	apolipoprotein receptor b inding	IPI	molecular_function
GO:0034191	apolipoprotein A-I recept or binding	IPI	molecular_function
GO:0034361	very-low-density lipoprot ein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IEA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034365	discoidal high-density li poprotein particle	IEA	cellular_component
GO:0034366	spherical high-density li poprotein particle	IDA	cellular_component
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	IC	biological_process
GO:0034380	high-density lipoprotein particle assembly	IDA	biological_process
GO:0034384	high-density lipoprotein particle clearance	IC	biological_process
GO:0034774	secretory granule lumen	TAS	cellular_component
GO:0035025	positive regulation of Rh o protein signal transduc tion	IDA	biological_process
GO:0042157	lipoprotein metabolic pro cess	IEA	biological_process
GO:0042157	lipoprotein metabolic pro cess	IBA	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	IEA	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042627	chylomicron	IBA	cellular_component
GO:0042632	cholesterol homeostasis	IMP	biological_process
GO:0042632	cholesterol homeostasis	IDA	biological_process
GO:0042802	identical protein binding	IEA	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043534	blood vessel endothelial cell migration	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0043691	reverse cholesterol trans port	IMP	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045499	chemorepellent activity	IDA	molecular_function
GO:0045723	positive regulation of fa tty acid biosynthetic pro cess	IBA	biological_process
GO:0050713	negative regulation of in terleukin-1 beta secretio n	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	IDA	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0050919	negative chemotaxis	IDA	biological_process
GO:0051006	positive regulation of li poprotein lipase activity	IBA	biological_process
GO:0051180	vitamin transport	IMP	biological_process
GO:0051345	positive regulation of hy drolase activity	IDA	biological_process
GO:0051346	negative regulation of hy drolase activity	IEA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IDA	biological_process
GO:0055085	transmembrane transport	TAS	biological_process
GO:0055091	phospholipid homeostasis	IDA	biological_process
GO:0055102	lipase inhibitor activity	IEA	molecular_function
GO:0060192	negative regulation of li pase activity	IEA	biological_process
GO:0060228	phosphatidylcholine-stero l O-acyltransferase activ ator activity	IDA	molecular_function
GO:0060354	negative regulation of ce ll adhesion molecule prod uction	IDA	biological_process
GO:0060761	negative regulation of re sponse to cytokine stimul us	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070328	triglyceride homeostasis	IDA	biological_process
GO:0070508	cholesterol import	IMP	biological_process
GO:0070653	high-density lipoprotein particle receptor binding	IPI	molecular_function
GO:0070653	high-density lipoprotein particle receptor binding	IPI	molecular_function
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:0071813	lipoprotein particle bind ing	IEA	molecular_function
GO:0072562	blood microparticle	IDA	cellular_component
GO:1900026	positive regulation of su bstrate adhesion-dependen t cell spreading	IDA	biological_process
GO:1903561	extracellular vesicle	IDA	cellular_component
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0070371	ERK1 and ERK2 cascade	IDA	biological_process
GO:0017127	cholesterol transporter a ctivity	IDA	molecular_function
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0001540	beta-amyloid binding	IDA	molecular_function
GO:0002576	platelet degranulation	TAS	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005543	phospholipid binding	IDA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	ISS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006656	phosphatidylcholine biosy nthetic process	IDA	biological_process
GO:0006695	cholesterol biosynthetic process	IBA	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0006898	receptor-mediated endocyt osis	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IDA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IDA	biological_process
GO:0008203	cholesterol metabolic pro cess	IMP	biological_process
GO:0010804	negative regulation of tu mor necrosis factor-media ted signaling pathway	IDA	biological_process
GO:0010873	positive regulation of ch olesterol esterification	IDA	biological_process
GO:0010898	positive regulation of tr iglyceride catabolic proc ess	IBA	biological_process
GO:0010903	negative regulation of ve ry-low-density lipoprotei n particle remodeling	IDA	biological_process
GO:0015485	cholesterol binding	IDA	molecular_function
GO:0017127	cholesterol transporter a ctivity	IMP	molecular_function
GO:0018158	protein oxidation	IDA	biological_process
GO:0018206	peptidyl-methionine modif ication	IDA	biological_process
GO:0019433	triglyceride catabolic pr ocess	IBA	biological_process
GO:0019899	enzyme binding	IPI	molecular_function
GO:0030139	endocytic vesicle	IDA	cellular_component
GO:0030300	regulation of intestinal cholesterol absorption	IBA	biological_process
GO:0030301	cholesterol transport	IDA	biological_process
GO:0031102	neuron projection regener ation	IBA	biological_process
GO:0031210	phosphatidylcholine bindi ng	IBA	molecular_function
GO:0031410	cytoplasmic vesicle	IDA	cellular_component
GO:0032489	regulation of Cdc42 prote in signal transduction	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IMP	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033700	phospholipid efflux	IDA	biological_process
GO:0033700	phospholipid efflux	IDA	biological_process
GO:0034115	negative regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0034190	apolipoprotein receptor b inding	IPI	molecular_function
GO:0034191	apolipoprotein A-I recept or binding	IPI	molecular_function
GO:0034361	very-low-density lipoprot ein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034366	spherical high-density li poprotein particle	IDA	cellular_component
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	IC	biological_process
GO:0034380	high-density lipoprotein particle assembly	IDA	biological_process
GO:0034384	high-density lipoprotein particle clearance	IC	biological_process
GO:0034774	secretory granule lumen	TAS	cellular_component
GO:0035025	positive regulation of Rh o protein signal transduc tion	IDA	biological_process
GO:0042157	lipoprotein metabolic pro cess	IBA	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042627	chylomicron	IBA	cellular_component
GO:0042632	cholesterol homeostasis	IMP	biological_process
GO:0042632	cholesterol homeostasis	IDA	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043691	reverse cholesterol trans port	IMP	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045499	chemorepellent activity	IDA	molecular_function
GO:0045723	positive regulation of fa tty acid biosynthetic pro cess	IBA	biological_process
GO:0050713	negative regulation of in terleukin-1 beta secretio n	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	IDA	biological_process
GO:0050821	protein stabilization	IDA	biological_process
GO:0050919	negative chemotaxis	IDA	biological_process
GO:0051006	positive regulation of li poprotein lipase activity	IBA	biological_process
GO:0051180	vitamin transport	IMP	biological_process
GO:0051345	positive regulation of hy drolase activity	IDA	biological_process
GO:0051496	positive regulation of st ress fiber assembly	IDA	biological_process
GO:0055085	transmembrane transport	TAS	biological_process
GO:0055091	phospholipid homeostasis	IDA	biological_process
GO:0060228	phosphatidylcholine-stero l O-acyltransferase activ ator activity	IDA	molecular_function
GO:0060354	negative regulation of ce ll adhesion molecule prod uction	IDA	biological_process
GO:0060761	negative regulation of re sponse to cytokine stimul us	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070328	triglyceride homeostasis	IDA	biological_process
GO:0070508	cholesterol import	IMP	biological_process
GO:0070653	high-density lipoprotein particle receptor binding	IPI	molecular_function
GO:0070653	high-density lipoprotein particle receptor binding	IPI	molecular_function
GO:0071682	endocytic vesicle lumen	TAS	cellular_component
GO:0072562	blood microparticle	IDA	cellular_component
GO:1900026	positive regulation of su bstrate adhesion-dependen t cell spreading	IDA	biological_process
GO:1903561	extracellular vesicle	IDA	cellular_component
GO:0007179	transforming growth facto r beta receptor signaling pathway	IDA	biological_process
GO:0070371	ERK1 and ERK2 cascade	IDA	biological_process
GO:0017127	cholesterol transporter a ctivity	IDA	molecular_function

KEGG pathways

hsa05143  African trypanosomiasis
hsa03320  PPAR signaling pathway
hsa04975  Fat digestion and absorption
hsa04977  Vitamin digestion and absorption

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 16136540
Cancer	PMID: 11771311
Cardiovascular disease	PMID: 12544508
Diabetes	PMID: 12732844
Endometriosis	PMID: 20008415
Familial amyloidosis	KEGG: H00845
Familial combined hyperlipoproteinemia	PMID: 9026529
Gout	PMID: 15115711
Hyperandrogenism	PMID: 22512822
Hyperlipidemia	PMID: 11737222
Hypertriglyceridemia	PMID: 19207029
Hyperuricemia	PMID: 15868628
Hypoalphalipoproteinemia	PMID: 12048121
Kidney disease	PMID: 19578796
Multiple sclerosis	PMID: 18805838
Osteonecrosis	PMID: 17530370
Polycystic ovary syndrome (PCOS)	PMID: 22703625
Endometriosis	INFBASE20008415
Unexplained infertility	PMID: 19230882

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
20008415	Endometrio sis				Female infertility	apoA-I	Show abstract