Endometriosis Knowledgebase

Search Result

Gene id

336

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

APOA2 Gene UCSC Ensembl

Aliases

Apo-AII, ApoA-II, apoAII

Gene name

apolipoprotein A2

Alternate names

apolipoprotein A-II,

Gene location

1q23.3 (161223627: 161222292) Exons: 4 NC_000001.11

Gene summary(Entrez)

This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. [provided by RefSeq, Jul 2008]

OMIM

107670

Protein Summary

Protein general information

P02652

Name: Apolipoprotein A II (Apo AII) (ApoA II) (Apolipoprotein A2) [Cleaved into: Proapolipoprotein A II (ProapoA II); Truncated apolipoprotein A II (Apolipoprotein A II(1 76))]

Length: 100 Mass: 11,175

Tissue specificity: Plasma; synthesized in the liver and intestine.

Sequence

MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPL
IKKAGTELVNFLSYFVELGTQPATQ

Structural information

Interpro:	IPR006801
PDB:	1L6L 2OU1
PDBsum:	1L6L 2OU1
MINT:	106326
STRING:	ENSP00000356969;

Other Databases

GeneCards: APOA2; Malacards: APOA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0002526	acute inflammatory respon se	IEA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0005319	lipid transporter activit y	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005543	phospholipid binding	IDA	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006641	triglyceride metabolic pr ocess	TAS	biological_process
GO:0006656	phosphatidylcholine biosy nthetic process	IDA	biological_process
GO:0008035	high-density lipoprotein particle binding	IBA	molecular_function
GO:0008203	cholesterol metabolic pro cess	IBA	biological_process
GO:0008289	lipid binding	IDA	molecular_function
GO:0009395	phospholipid catabolic pr ocess	IDA	biological_process
GO:0009749	response to glucose	IDA	biological_process
GO:0010873	positive regulation of ch olesterol esterification	IDA	biological_process
GO:0010903	negative regulation of ve ry-low-density lipoprotei n particle remodeling	IDA	biological_process
GO:0015485	cholesterol binding	IDA	molecular_function
GO:0016032	viral process	IEA	biological_process
GO:0018158	protein oxidation	IDA	biological_process
GO:0018206	peptidyl-methionine modif ication	IDA	biological_process
GO:0030300	regulation of intestinal cholesterol absorption	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031210	phosphatidylcholine bindi ng	IDA	molecular_function
GO:0031647	regulation of protein sta bility	IDA	biological_process
GO:0032375	negative regulation of ch olesterol transport	IMP	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033700	phospholipid efflux	IDA	biological_process
GO:0034190	apolipoprotein receptor b inding	IPI	molecular_function
GO:0034361	very-low-density lipoprot ein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034366	spherical high-density li poprotein particle	IDA	cellular_component
GO:0034370	triglyceride-rich lipopro tein particle remodeling	IDA	biological_process
GO:0034374	low-density lipoprotein p article remodeling	IDA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological_process
GO:0034380	high-density lipoprotein particle assembly	IDA	biological_process
GO:0034384	high-density lipoprotein particle clearance	IDA	biological_process
GO:0042157	lipoprotein metabolic pro cess	IBA	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042627	chylomicron	IDA	cellular_component
GO:0042632	cholesterol homeostasis	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0043691	reverse cholesterol trans port	IDA	biological_process
GO:0045416	positive regulation of in terleukin-8 biosynthetic process	IDA	biological_process
GO:0046340	diacylglycerol catabolic process	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0050995	negative regulation of li pid catabolic process	IDA	biological_process
GO:0050996	positive regulation of li pid catabolic process	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0055102	lipase inhibitor activity	IDA	molecular_function
GO:0060192	negative regulation of li pase activity	IDA	biological_process
GO:0060228	phosphatidylcholine-stero l O-acyltransferase activ ator activity	IDA	molecular_function
GO:0060621	negative regulation of ch olesterol import	IDA	biological_process
GO:0060695	negative regulation of ch olesterol transporter act ivity	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070653	high-density lipoprotein particle receptor binding	IPI	molecular_function
GO:0072562	blood microparticle	IDA	cellular_component
GO:0017127	cholesterol transporter a ctivity	IDA	molecular_function
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0002526	acute inflammatory respon se	IEA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0005319	lipid transporter activit y	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005543	phospholipid binding	IDA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006641	triglyceride metabolic pr ocess	TAS	biological_process
GO:0006656	phosphatidylcholine biosy nthetic process	IDA	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006869	lipid transport	IEA	biological_process
GO:0006869	lipid transport	IEA	biological_process
GO:0006869	lipid transport	IEA	biological_process
GO:0008035	high-density lipoprotein particle binding	IEA	molecular_function
GO:0008035	high-density lipoprotein particle binding	IBA	molecular_function
GO:0008203	cholesterol metabolic pro cess	IEA	biological_process
GO:0008203	cholesterol metabolic pro cess	IBA	biological_process
GO:0008289	lipid binding	IEA	molecular_function
GO:0008289	lipid binding	IDA	molecular_function
GO:0009395	phospholipid catabolic pr ocess	IDA	biological_process
GO:0009749	response to glucose	IDA	biological_process
GO:0010873	positive regulation of ch olesterol esterification	IDA	biological_process
GO:0010903	negative regulation of ve ry-low-density lipoprotei n particle remodeling	IDA	biological_process
GO:0015485	cholesterol binding	IDA	molecular_function
GO:0016032	viral process	IEA	biological_process
GO:0017127	cholesterol transporter a ctivity	IEA	molecular_function
GO:0018158	protein oxidation	IDA	biological_process
GO:0018206	peptidyl-methionine modif ication	IDA	biological_process
GO:0030300	regulation of intestinal cholesterol absorption	IEA	biological_process
GO:0030301	cholesterol transport	IEA	biological_process
GO:0031100	animal organ regeneration	IEA	biological_process
GO:0031210	phosphatidylcholine bindi ng	IDA	molecular_function
GO:0031647	regulation of protein sta bility	IDA	biological_process
GO:0032375	negative regulation of ch olesterol transport	IMP	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033700	phospholipid efflux	IDA	biological_process
GO:0034190	apolipoprotein receptor b inding	IPI	molecular_function
GO:0034361	very-low-density lipoprot ein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IEA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034366	spherical high-density li poprotein particle	IDA	cellular_component
GO:0034370	triglyceride-rich lipopro tein particle remodeling	IDA	biological_process
GO:0034374	low-density lipoprotein p article remodeling	IDA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological_process
GO:0034380	high-density lipoprotein particle assembly	IDA	biological_process
GO:0034384	high-density lipoprotein particle clearance	IDA	biological_process
GO:0042157	lipoprotein metabolic pro cess	IEA	biological_process
GO:0042157	lipoprotein metabolic pro cess	IEA	biological_process
GO:0042157	lipoprotein metabolic pro cess	IBA	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042627	chylomicron	IDA	cellular_component
GO:0042632	cholesterol homeostasis	IEA	biological_process
GO:0042632	cholesterol homeostasis	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0043691	reverse cholesterol trans port	IDA	biological_process
GO:0045416	positive regulation of in terleukin-8 biosynthetic process	IDA	biological_process
GO:0046340	diacylglycerol catabolic process	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0050995	negative regulation of li pid catabolic process	IDA	biological_process
GO:0050996	positive regulation of li pid catabolic process	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0055102	lipase inhibitor activity	IDA	molecular_function
GO:0060192	negative regulation of li pase activity	IEA	biological_process
GO:0060192	negative regulation of li pase activity	IDA	biological_process
GO:0060228	phosphatidylcholine-stero l O-acyltransferase activ ator activity	IDA	molecular_function
GO:0060621	negative regulation of ch olesterol import	IDA	biological_process
GO:0060695	negative regulation of ch olesterol transporter act ivity	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070653	high-density lipoprotein particle receptor binding	IPI	molecular_function
GO:0072562	blood microparticle	IDA	cellular_component
GO:0017127	cholesterol transporter a ctivity	IDA	molecular_function
GO:0001523	retinoid metabolic proces s	TAS	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0005319	lipid transporter activit y	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005543	phospholipid binding	IDA	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005769	early endosome	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005788	endoplasmic reticulum lum en	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006641	triglyceride metabolic pr ocess	TAS	biological_process
GO:0006656	phosphatidylcholine biosy nthetic process	IDA	biological_process
GO:0008035	high-density lipoprotein particle binding	IBA	molecular_function
GO:0008203	cholesterol metabolic pro cess	IBA	biological_process
GO:0008289	lipid binding	IDA	molecular_function
GO:0009395	phospholipid catabolic pr ocess	IDA	biological_process
GO:0009749	response to glucose	IDA	biological_process
GO:0010873	positive regulation of ch olesterol esterification	IDA	biological_process
GO:0010903	negative regulation of ve ry-low-density lipoprotei n particle remodeling	IDA	biological_process
GO:0015485	cholesterol binding	IDA	molecular_function
GO:0018158	protein oxidation	IDA	biological_process
GO:0018206	peptidyl-methionine modif ication	IDA	biological_process
GO:0031210	phosphatidylcholine bindi ng	IDA	molecular_function
GO:0031647	regulation of protein sta bility	IDA	biological_process
GO:0032375	negative regulation of ch olesterol transport	IMP	biological_process
GO:0033344	cholesterol efflux	IDA	biological_process
GO:0033700	phospholipid efflux	IDA	biological_process
GO:0034190	apolipoprotein receptor b inding	IPI	molecular_function
GO:0034361	very-low-density lipoprot ein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034364	high-density lipoprotein particle	IDA	cellular_component
GO:0034366	spherical high-density li poprotein particle	IDA	cellular_component
GO:0034370	triglyceride-rich lipopro tein particle remodeling	IDA	biological_process
GO:0034374	low-density lipoprotein p article remodeling	IDA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological_process
GO:0034375	high-density lipoprotein particle remodeling	IDA	biological_process
GO:0034380	high-density lipoprotein particle assembly	IDA	biological_process
GO:0034384	high-density lipoprotein particle clearance	IDA	biological_process
GO:0042157	lipoprotein metabolic pro cess	IBA	biological_process
GO:0042157	lipoprotein metabolic pro cess	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042158	lipoprotein biosynthetic process	TAS	biological_process
GO:0042627	chylomicron	IDA	cellular_component
GO:0042632	cholesterol homeostasis	IDA	biological_process
GO:0042803	protein homodimerization activity	IDA	molecular_function
GO:0043691	reverse cholesterol trans port	IDA	biological_process
GO:0045416	positive regulation of in terleukin-8 biosynthetic process	IDA	biological_process
GO:0046340	diacylglycerol catabolic process	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0050995	negative regulation of li pid catabolic process	IDA	biological_process
GO:0050996	positive regulation of li pid catabolic process	IDA	biological_process
GO:0055102	lipase inhibitor activity	IDA	molecular_function
GO:0060192	negative regulation of li pase activity	IDA	biological_process
GO:0060228	phosphatidylcholine-stero l O-acyltransferase activ ator activity	IDA	molecular_function
GO:0060621	negative regulation of ch olesterol import	IDA	biological_process
GO:0060695	negative regulation of ch olesterol transporter act ivity	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070653	high-density lipoprotein particle receptor binding	IPI	molecular_function
GO:0072562	blood microparticle	IDA	cellular_component
GO:0017127	cholesterol transporter a ctivity	IDA	molecular_function

KEGG pathways

hsa03320 PPAR signaling pathway

Diseases

Associated diseases	References
Apolipoprotein A-II deficiency	OMIM: 107670
Cancer	PMID: 18676680
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Diabetes	PMID: 19216768
Endometriosis	PMID: 11163832
Hypercholesterolemia	OMIM: 107670
Hypertriglyceridemia	PMID: 9489233
Obesity	PMID: 19901143
Endometriosis	INFBASE11163832

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
11163832	Endometrio sis						Show abstract