Endometriosis Knowledgebase

Search Result

Gene id

3371

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

TNC Gene UCSC Ensembl

Aliases

150-225, DFNA56, GMEM, GP, HXB, JI, TN, TN-C

Gene name

tenascin C

Alternate names

tenascin, GP 150-225, cytotactin, deafness, autosomal dominant 56, glioma-associated-extracellular matrix antigen, hexabrachion (tenascin), myotendinous antigen, neuronectin, tenascin-C additional domain 1, tenascin-C isoform 14/AD1/16,

Gene location

9q33.1 (115118256: 115019574) Exons: 30 NC_000009.12

Gene summary(Entrez)

This gene encodes an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. It is implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity, and neuronal regeneration. [provided by RefSeq, Jul 2011]

OMIM

187380

Protein Summary

Protein general information

P24821

Name: Tenascin (TN) (Cytotactin) (GMEM) (GP 150 225) (Glioma associated extracellular matrix antigen) (Hexabrachion) (JI) (Myotendinous antigen) (Neuronectin) (Tenascin C) (TN C)

Length: 2201 Mass: 240,853

Sequence

MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPVGSQCSVDLESASGEK
DLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVKELLSRLEELENLVSSLREQCTAGAGCCLQP
ATGRLDTRPFCSGRGNFSTEGCGCVCEPGWKGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDC
NDQGKCVNGVCICFEGYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQCVCDEGFAGVDCSEK
RCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVNGQCVCDEGYTGEDCSQLRCPNDCHSRGRCV
EGKCVCEQGFKGYDCSDMSCPNDCHQHGRCVNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGP
DCAELSCPNDCHGQGRCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNN
LGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTHEGGLEMQFRVPGDQT
STIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKFKSIKETSVEVEWDPLDIAFETWEIIFRNMN
KEDEGEITKSLRRPETSYRQTGLAPGQEYEISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFK
PLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTEYGIGVSAVKEDKESN
PATINAATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYSLPTGQWVGVQLPRNTTSYVLRGLEPGQEYN
VLLTAEKGRHKSKPARVKASTEQAPELENLTVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAARNLTVPGS
LRAVDIPGLKAATPYTVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAEVGWDALKLNWTAPEGAYEYFFIQVQ
EADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMGNLTVTEVSWDALRLN
WTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSMEIPGLRAGTPYTVTLHGEVRGHSTRPLAVEVVTEDLPQL
GDLAVSEVGWDGLRLNWTAADNAYEHFVIQVQEVNKVEAAQNLTLPGSLRAVDIPGLEAATPYRVSIYGVIRGYR
TPVLSAEASTAKEPEIGNLNVSDITPESFNLSWMATDGIFETFTIEIIDSNRLLETVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFLVTVVDSGKLLDPQEF
TLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAEPEVDNLLVSDATPDGFRLSWTADEGVFDNF
VLKIRDTKKQSEPLEITLLAPERTRDITGLREATEYEIELYGISKGRRSQTVSAIATTAMGSPKEVIFSDITENS
ATVSWRAPTAQVESFRITYVPITGGTPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALD
GPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFAEKGPQK
SSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTH
YTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIV
FLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGH
EHSIQFAEMKLRPSNFRNLEGRRKRA

Structural information

Protein Domains	EGF-like (174-186) ({ECO:0000255\|PROSITE-ProRule:PRU00076}-) EGF-like (186-217) EGF-like (217-248) EGF-like (248-280)
Interpro:	IPR013032 IPR000742 IPR013111 IPR014716 IPR014715 IPR002181 IPR003961 IPR013783 IPR033078
Prosite:	PS00022 PS01186 PS50026 PS51406 PS50853
Pfam:	PF07974 PF00147 PF00041
CDD:	cd00063 cd00087
PDB:	1TEN 2RB8 2RBL
PDBsum:	1TEN 2RB8 2RBL
STRING:	ENSP00000265131;

Other Databases

GeneCards: TNC; Malacards: TNC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005614	interstitial matrix	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007162	negative regulation of ce ll adhesion	IEA	biological_process
GO:0007528	neuromuscular junction de velopment	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0009611	response to wounding	IEP	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0014012	peripheral nervous system axon regeneration	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0042060	wound healing	IEA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045545	syndecan binding	IDA	molecular_function
GO:0060447	bud outgrowth involved in lung branching	IEA	biological_process
GO:0060739	mesenchymal-epithelial ce ll signaling involved in prostate gland developmen t	IEA	biological_process
GO:0060740	prostate gland epithelium morphogenesis	IEA	biological_process
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0071305	cellular response to vita min D	IEA	biological_process
GO:0071774	response to fibroblast gr owth factor	IEA	biological_process
GO:0071799	cellular response to pros taglandin D stimulus	IEA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005578	proteinaceous extracellul ar matrix	IEA	cellular_component
GO:0005604	basement membrane	IEA	cellular_component
GO:0005614	interstitial matrix	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007162	negative regulation of ce ll adhesion	IEA	biological_process
GO:0007528	neuromuscular junction de velopment	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0009611	response to wounding	IEP	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0014012	peripheral nervous system axon regeneration	IEA	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0031012	extracellular matrix	IEA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031175	neuron projection develop ment	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045545	syndecan binding	IDA	molecular_function
GO:0060447	bud outgrowth involved in lung branching	IEA	biological_process
GO:0060739	mesenchymal-epithelial ce ll signaling involved in prostate gland developmen t	IEA	biological_process
GO:0060740	prostate gland epithelium morphogenesis	IEA	biological_process
GO:0071300	cellular response to reti noic acid	IEA	biological_process
GO:0071305	cellular response to vita min D	IEA	biological_process
GO:0071774	response to fibroblast gr owth factor	IEA	biological_process
GO:0071799	cellular response to pros taglandin D stimulus	IEA	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component
GO:0001649	osteoblast differentiatio n	IDA	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	TAS	biological_process
GO:0009611	response to wounding	IEP	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0045545	syndecan binding	IDA	molecular_function
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0031012	extracellular matrix	ISS	cellular_component

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa05206  MicroRNAs in cancer
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction

Diseases

Associated diseases	References
Asthma	PMID: 16115819
Cancer	PMID: 22219177
Deafness	OMIM: 187380
Endometriosis	PMID: 10365101
Endometriosis	INFBASE10365101
Spondylarthritis	PMID: 18815154

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
17681310	Endometrio sis					Tenascin	Show abstract
10365101	Endometrio sis					Tenascin	Show abstract