Endometriosis Knowledgebase

Search Result

Gene id

3398

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ID2 Gene UCSC Ensembl

Aliases

GIG8, ID2A, ID2H, bHLHb26

Gene name

inhibitor of DNA binding 2

Alternate names

DNA-binding protein inhibitor ID-2, DNA-binding protein inhibitor ID2, cell growth-inhibiting gene 8, class B basic helix-loop-helix protein 26, helix-loop-helix protein ID2, inhibitor of DNA binding 2, HLH protein, inhibitor of DNA binding 2, dominant negative helix-loop-helix protein, inhibitor of differentiation 2,

Gene location

2p25.1 (8681982: 8684452) Exons: 3 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3. [provided by RefSeq, Aug 2011]

OMIM

600386

Protein Summary

Protein general information

Q02363

Name: DNA-binding protein inhibitor ID-2 (Class B basic helix-loop-helix protein 26) (bHLHb26) (Inhibitor of DNA binding 2) (Inhibitor of differentiation 2)

Length: 134 Mass: 14,917

Tissue specificity: Highly expressed in early fetal tissues, including those of the central nervous system.

Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDL
QIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Structural information

Protein Domains	bHLH. (23-75)
Motifs	Nuclear export(106-115)
Interpro:	IPR011598 IPR026052 IPR036638
Prosite:	PS50888
Pfam:	PF00010
CDD:	cd00083
PDB:	4AYA
PDBsum:	4AYA
DIP:	46874
MINT:
STRING:	ENSP00000234091;

Other Databases

GeneCards: ID2; Malacards: ID2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0001656	metanephros development	IEA	biological_process
GO:0001779	natural killer cell diffe rentiation	IEA	biological_process
GO:0001966	thigmotaxis	IEA	biological_process
GO:0003149	membranous septum morphog enesis	IEA	biological_process
GO:0003166	bundle of His development	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0008344	adult locomotory behavior	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	ISS	biological_process
GO:0014003	oligodendrocyte developme nt	IEA	biological_process
GO:0019216	regulation of lipid metab olic process	ISS	biological_process
GO:0021772	olfactory bulb developmen t	IEA	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0033598	mammary gland epithelial cell proliferation	ISS	biological_process
GO:0042752	regulation of circadian r hythm	ISS	biological_process
GO:0043153	entrainment of circadian clock by photoperiod	ISS	biological_process
GO:0043234	protein complex	ISS	cellular_component
GO:0043353	enucleate erythrocyte dif ferentiation	IEA	biological_process
GO:0043392	negative regulation of DN A binding	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0044325	ion channel binding	IPI	molecular_function
GO:0045475	locomotor rhythm	ISS	biological_process
GO:0045578	negative regulation of B cell differentiation	IEA	biological_process
GO:0045600	positive regulation of fa t cell differentiation	IEA	biological_process
GO:0045648	positive regulation of er ythrocyte differentiation	IEA	biological_process
GO:0045651	positive regulation of ma crophage differentiation	IEA	biological_process
GO:0045665	negative regulation of ne uron differentiation	ISS	biological_process
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0045777	positive regulation of bl ood pressure	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046983	protein dimerization acti vity	IEA	molecular_function
GO:0048469	cell maturation	IEA	biological_process
GO:0048541	Peyer's patch development	IEA	biological_process
GO:0048557	embryonic digestive tract morphogenesis	ISS	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	ISS	biological_process
GO:0048663	neuron fate commitment	ISS	biological_process
GO:0048667	cell morphogenesis involv ed in neuron differentiat ion	IEA	biological_process
GO:0048711	positive regulation of as trocyte differentiation	IEA	biological_process
GO:0048715	negative regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0060612	adipose tissue developmen t	IEA	biological_process
GO:0060749	mammary gland alveolus de velopment	ISS	biological_process
GO:0061030	epithelial cell different iation involved in mammar y gland alveolus developm ent	ISS	biological_process
GO:0061031	endodermal digestive trac t morphogenesis	ISS	biological_process
GO:0071158	positive regulation of ce ll cycle arrest	ISS	biological_process
GO:0071285	cellular response to lith ium ion	IEA	biological_process
GO:0071931	positive regulation of tr anscription involved in G 1/S transition of mitotic cell cycle	IC	biological_process
GO:0090398	cellular senescence	ISS	biological_process
GO:2000045	regulation of G1/S transi tion of mitotic cell cycl e	IMP	biological_process
GO:2000178	negative regulation of ne ural precursor cell proli feration	ISS	biological_process
GO:0005737	cytoplasm	IDA	cellular_component
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0001656	metanephros development	IEA	biological_process
GO:0001779	natural killer cell diffe rentiation	IEA	biological_process
GO:0001966	thigmotaxis	IEA	biological_process
GO:0002521	leukocyte differentiation	IEA	biological_process
GO:0003149	membranous septum morphog enesis	IEA	biological_process
GO:0003166	bundle of His development	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IC	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0006351	transcription, DNA-templa ted	IEA	biological_process
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0007275	multicellular organism de velopment	IEA	biological_process
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0007507	heart development	IEA	biological_process
GO:0007623	circadian rhythm	IEA	biological_process
GO:0008344	adult locomotory behavior	IEA	biological_process
GO:0009649	entrainment of circadian clock	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010629	negative regulation of ge ne expression	ISS	biological_process
GO:0014003	oligodendrocyte developme nt	IEA	biological_process
GO:0019216	regulation of lipid metab olic process	IEA	biological_process
GO:0019216	regulation of lipid metab olic process	ISS	biological_process
GO:0021772	olfactory bulb developmen t	IEA	biological_process
GO:0032922	circadian regulation of g ene expression	IEA	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0033598	mammary gland epithelial cell proliferation	IEA	biological_process
GO:0033598	mammary gland epithelial cell proliferation	ISS	biological_process
GO:0042752	regulation of circadian r hythm	IEA	biological_process
GO:0042752	regulation of circadian r hythm	ISS	biological_process
GO:0043153	entrainment of circadian clock by photoperiod	IEA	biological_process
GO:0043153	entrainment of circadian clock by photoperiod	ISS	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0043234	protein complex	ISS	cellular_component
GO:0043353	enucleate erythrocyte dif ferentiation	IEA	biological_process
GO:0043392	negative regulation of DN A binding	IEA	biological_process
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0044325	ion channel binding	IPI	molecular_function
GO:0045475	locomotor rhythm	IEA	biological_process
GO:0045475	locomotor rhythm	ISS	biological_process
GO:0045578	negative regulation of B cell differentiation	IEA	biological_process
GO:0045600	positive regulation of fa t cell differentiation	IEA	biological_process
GO:0045648	positive regulation of er ythrocyte differentiation	IEA	biological_process
GO:0045651	positive regulation of ma crophage differentiation	IEA	biological_process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological_process
GO:0045665	negative regulation of ne uron differentiation	ISS	biological_process
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0045777	positive regulation of bl ood pressure	IEA	biological_process
GO:0045777	positive regulation of bl ood pressure	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0046983	protein dimerization acti vity	IEA	molecular_function
GO:0048468	cell development	IEA	biological_process
GO:0048469	cell maturation	IEA	biological_process
GO:0048511	rhythmic process	IEA	biological_process
GO:0048541	Peyer's patch development	IEA	biological_process
GO:0048557	embryonic digestive tract morphogenesis	IEA	biological_process
GO:0048557	embryonic digestive tract morphogenesis	ISS	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	ISS	biological_process
GO:0048663	neuron fate commitment	IEA	biological_process
GO:0048663	neuron fate commitment	ISS	biological_process
GO:0048667	cell morphogenesis involv ed in neuron differentiat ion	IEA	biological_process
GO:0048711	positive regulation of as trocyte differentiation	IEA	biological_process
GO:0048715	negative regulation of ol igodendrocyte differentia tion	IEA	biological_process
GO:0060612	adipose tissue developmen t	IEA	biological_process
GO:0060749	mammary gland alveolus de velopment	IEA	biological_process
GO:0060749	mammary gland alveolus de velopment	ISS	biological_process
GO:0061030	epithelial cell different iation involved in mammar y gland alveolus developm ent	IEA	biological_process
GO:0061030	epithelial cell different iation involved in mammar y gland alveolus developm ent	ISS	biological_process
GO:0061031	endodermal digestive trac t morphogenesis	IEA	biological_process
GO:0061031	endodermal digestive trac t morphogenesis	ISS	biological_process
GO:0071158	positive regulation of ce ll cycle arrest	IEA	biological_process
GO:0071158	positive regulation of ce ll cycle arrest	ISS	biological_process
GO:0071285	cellular response to lith ium ion	IEA	biological_process
GO:0071931	positive regulation of tr anscription involved in G 1/S transition of mitotic cell cycle	IC	biological_process
GO:0090398	cellular senescence	IEA	biological_process
GO:0090398	cellular senescence	ISS	biological_process
GO:2000045	regulation of G1/S transi tion of mitotic cell cycl e	IMP	biological_process
GO:2000178	negative regulation of ne ural precursor cell proli feration	IEA	biological_process
GO:2000178	negative regulation of ne ural precursor cell proli feration	ISS	biological_process
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005634	nucleus	IC	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005813	centrosome	IDA	cellular_component
GO:0005829	cytosol	IDA	cellular_component
GO:0007275	multicellular organism de velopment	TAS	biological_process
GO:0010628	positive regulation of ge ne expression	ISS	biological_process
GO:0010629	negative regulation of ge ne expression	ISS	biological_process
GO:0019216	regulation of lipid metab olic process	ISS	biological_process
GO:0032922	circadian regulation of g ene expression	ISS	biological_process
GO:0033598	mammary gland epithelial cell proliferation	ISS	biological_process
GO:0042752	regulation of circadian r hythm	ISS	biological_process
GO:0043153	entrainment of circadian clock by photoperiod	ISS	biological_process
GO:0043234	protein complex	ISS	cellular_component
GO:0043433	negative regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0044325	ion channel binding	IPI	molecular_function
GO:0045475	locomotor rhythm	ISS	biological_process
GO:0045665	negative regulation of ne uron differentiation	ISS	biological_process
GO:0045777	positive regulation of bl ood pressure	ISS	biological_process
GO:0045892	negative regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	ISS	biological_process
GO:0048557	embryonic digestive tract morphogenesis	ISS	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	ISS	biological_process
GO:0048663	neuron fate commitment	ISS	biological_process
GO:0060749	mammary gland alveolus de velopment	ISS	biological_process
GO:0061030	epithelial cell different iation involved in mammar y gland alveolus developm ent	ISS	biological_process
GO:0061031	endodermal digestive trac t morphogenesis	ISS	biological_process
GO:0071158	positive regulation of ce ll cycle arrest	ISS	biological_process
GO:0071931	positive regulation of tr anscription involved in G 1/S transition of mitotic cell cycle	IC	biological_process
GO:0090398	cellular senescence	ISS	biological_process
GO:2000045	regulation of G1/S transi tion of mitotic cell cycl e	IMP	biological_process
GO:2000178	negative regulation of ne ural precursor cell proli feration	ISS	biological_process
GO:0005737	cytoplasm	IDA	cellular_component

KEGG pathways

hsa04350  TGF-beta signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04390  Hippo signaling pathway

Diseases

Associated diseases	References
Ovarian endometriosis	INFBASE28678915
Endometriosis	INFBASE27385728

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
28678915	Endometrio sis	36 (10 from end ometrial and pe ritoneal endome triotic lesions , 10 from endom etrial and ovar ian endometriot ic lesions, 16 endometrium sam ples were colle cted from women without endome triosis)		Show abstract
27385728	Endometrio sis			Show abstract
28678915	Endometrio sis (ovari an)	30 (10 from end ometrial and pe ritoneal endome triotic lesions and 10 from en dometrial and o varian endometr iotic lesions, 16 from women w ithout endometr iosis)	ID2 PRELP and SMOC2	Show abstract