Endometriosis Knowledgebase

Search Result

Gene id

343

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

AQP8 Gene UCSC Ensembl

Aliases

AQP-8

Gene name

aquaporin 8

Alternate names

aquaporin-8,

Gene location

16p12.1 (25216916: 25228931) Exons: 6 NC_000016.10

Gene summary(Entrez)

Aquaporin 8 (AQP8) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 8 mRNA is found in pancreas and colon but not other tissues. [provided by RefSeq, Jul 2008]

OMIM

603750

Protein Summary

Protein general information

O94778

Name: Aquaporin 8 (AQP 8)

Length: 261 Mass: 27,381

Tissue specificity: Expressed only in pancreas and colon.

Sequence

MSGEIAMCEPEFGNDKAREPSVGGRWRVSWYERFVQPCLVELLGSALFIFIGCLSVIENGTDTGLLQPALAHGLA
LGLVIATLGNISGGHFNPAVSLAAMLIGGLNLVMLLPYWVSQLLGGMLGAALAKAVSPEERFWNASGAAFVTVQE
QGQVAGALVAEIILTTLLALAVCMGAINEKTKGPLAPFSIGFAVTVDILAGGPVSGGCMNPARAFGPAVVANHWN
FHWIYWLGPLLAGLLVGLLIRCFIGDGKTRLILKAR

Structural information

Motifs	NPA 1(92-94) NPA 2.(210-212)
Interpro:	IPR023271 IPR023277 IPR034294 IPR000425 IPR022357
Prosite:	PS00221
Pfam:	PF00230
STRING:	ENSP00000219660;

Other Databases

GeneCards: AQP8; Malacards: AQP8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006810	transport	TAS	biological_process
GO:0006833	water transport	TAS	biological_process
GO:0009992	cellular water homeostasi s	IBA	biological_process
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015254	glycerol channel activity	IBA	molecular_function
GO:0015793	glycerol transport	IEA	biological_process
GO:0034220	ion transmembrane transpo rt	IBA	biological_process
GO:0045177	apical part of cell	IDA	cellular_component
GO:0071320	cellular response to cAMP	IEP	biological_process
GO:0005215	transporter activity	IEA	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006810	transport	IEA	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006810	transport	TAS	biological_process
GO:0006833	water transport	TAS	biological_process
GO:0006833	water transport	TAS	biological_process
GO:0009992	cellular water homeostasi s	IBA	biological_process
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	TAS	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015254	glycerol channel activity	IBA	molecular_function
GO:0015793	glycerol transport	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0034220	ion transmembrane transpo rt	IBA	biological_process
GO:0045177	apical part of cell	IDA	cellular_component
GO:0071320	cellular response to cAMP	IEP	biological_process
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006810	transport	TAS	biological_process
GO:0006833	water transport	TAS	biological_process
GO:0006833	water transport	TAS	biological_process
GO:0009992	cellular water homeostasi s	IBA	biological_process
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	TAS	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015254	glycerol channel activity	IBA	molecular_function
GO:0034220	ion transmembrane transpo rt	IBA	biological_process
GO:0045177	apical part of cell	IDA	cellular_component
GO:0071320	cellular response to cAMP	IEP	biological_process

KEGG pathways

hsa04976 Bile secretion

Diseases

Associated diseases	References
Endometriosis	PMID: 19931078
Polycystic ovary syndrome (PCOS)	PMID: 23953589
Endometriosis	INFBASE19931078

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19931078	Endometrio sis			70 women with e ndometriomas		Aquaporins 2 5 8	Show abstract