Endometriosis Knowledgebase

Search Result

Gene id

3458

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IFNG Gene UCSC Ensembl

Aliases

IFG, IFI

Gene name

interferon gamma

Alternate names

interferon gamma, IFN-gamma, immune interferon,

Gene location

12q15 (68159740: 68154769) Exons: 4 NC_000012.12

Gene summary(Entrez)

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]

OMIM

147570

Protein Summary

Protein general information

P01579

Name: Interferon gamma (IFN gamma) (Immune interferon)

Length: 166 Mass: 19,348

Tissue specificity: Released primarily from activated T lymphocytes.

Sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSF
YFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTG
KRKRSQMLFRGRRASQ

Structural information

Interpro:	IPR009079 IPR002069
Pfam:	PF00714
PDB:	1EKU 1FG9 1FYH 1HIG 3BES
PDBsum:	1EKU 1FG9 1FYH 1HIG 3BES
DIP:	483
MINT:	1508034
STRING:	ENSP00000229135;

Other Databases

GeneCards: IFNG; Malacards: IFNG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000060	protein import into nucle us, translocation	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0001781	neutrophil apoptotic proc ess	IEA	biological_process
GO:0002026	regulation of the force o f heart contraction	IEA	biological_process
GO:0002250	adaptive immune response	IBA	biological_process
GO:0002302	CD8-positive, alpha-beta T cell differentiation in volved in immune response	IEA	biological_process
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005133	interferon-gamma receptor binding	IEA	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0006915	apoptotic process	IGI	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006959	humoral immune response	IBA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010508	positive regulation of au tophagy	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	IDA	biological_process
GO:0019882	antigen processing and pr esentation	IEA	biological_process
GO:0030593	neutrophil chemotaxis	IEA	biological_process
GO:0030857	negative regulation of ep ithelial cell differentia tion	ISS	biological_process
GO:0030968	endoplasmic reticulum unf olded protein response	IEA	biological_process
GO:0031642	negative regulation of my elination	IEA	biological_process
GO:0032224	positive regulation of sy naptic transmission, chol inergic	IEA	biological_process
GO:0032700	negative regulation of in terleukin-17 production	IDA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological_process
GO:0032747	positive regulation of in terleukin-23 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032834	positive regulation of CD 4-positive, CD25-positive , alpha-beta regulatory T cell differentiation inv olved in immune response	IDA	biological_process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	IDA	biological_process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	NAS	biological_process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	IDA	biological_process
GO:0042102	positive regulation of T cell proliferation	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological_process
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0042832	defense response to proto zoan	IEA	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	IEA	biological_process
GO:0045084	positive regulation of in terleukin-12 biosynthetic process	IEA	biological_process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IEA	biological_process
GO:0045410	positive regulation of in terleukin-6 biosynthetic process	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0048304	positive regulation of is otype switching to IgG is otypes	IEA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IEA	biological_process
GO:0050796	regulation of insulin sec retion	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	IEA	biological_process
GO:0050954	sensory perception of mec hanical stimulus	IEA	biological_process
GO:0051044	positive regulation of me mbrane protein ectodomain proteolysis	IDA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0051712	positive regulation of ki lling of cells of other o rganism	IDA	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological_process
GO:0060550	positive regulation of fr uctose 1,6-bisphosphate 1 -phosphatase activity	IDA	biological_process
GO:0060552	positive regulation of fr uctose 1,6-bisphosphate m etabolic process	IDA	biological_process
GO:0060557	positive regulation of vi tamin D biosynthetic proc ess	IDA	biological_process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071351	cellular response to inte rleukin-18	IEA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0098908	regulation of neuronal ac tion potential	IEA	biological_process
GO:1903543	positive regulation of ex osomal secretion	IDA	biological_process
GO:2000309	positive regulation of tu mor necrosis factor (liga nd) superfamily member 11 production	IDA	biological_process
GO:2000345	regulation of hepatocyte proliferation	IEA	biological_process
GO:0000060	protein import into nucle us, translocation	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0001781	neutrophil apoptotic proc ess	IEA	biological_process
GO:0002026	regulation of the force o f heart contraction	IEA	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002250	adaptive immune response	IBA	biological_process
GO:0002302	CD8-positive, alpha-beta T cell differentiation in volved in immune response	IEA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005133	interferon-gamma receptor binding	IEA	molecular_function
GO:0005133	interferon-gamma receptor binding	TAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological_process
GO:0006915	apoptotic process	IGI	biological_process
GO:0006925	inflammatory cell apoptot ic process	IEA	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006959	humoral immune response	IEA	biological_process
GO:0006959	humoral immune response	IBA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010508	positive regulation of au tophagy	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	IDA	biological_process
GO:0019882	antigen processing and pr esentation	IEA	biological_process
GO:0030593	neutrophil chemotaxis	IEA	biological_process
GO:0030857	negative regulation of ep ithelial cell differentia tion	IEA	biological_process
GO:0030857	negative regulation of ep ithelial cell differentia tion	ISS	biological_process
GO:0030968	endoplasmic reticulum unf olded protein response	IEA	biological_process
GO:0031642	negative regulation of my elination	IEA	biological_process
GO:0032224	positive regulation of sy naptic transmission, chol inergic	IEA	biological_process
GO:0032700	negative regulation of in terleukin-17 production	IDA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IEA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological_process
GO:0032747	positive regulation of in terleukin-23 production	IDA	biological_process
GO:0032760	positive regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032834	positive regulation of CD 4-positive, CD25-positive , alpha-beta regulatory T cell differentiation inv olved in immune response	IDA	biological_process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	IEA	biological_process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	IDA	biological_process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	NAS	biological_process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	IDA	biological_process
GO:0040008	regulation of growth	IEA	biological_process
GO:0042102	positive regulation of T cell proliferation	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IEA	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological_process
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0042832	defense response to proto zoan	IEA	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0044146	negative regulation of gr owth of symbiont involved in interaction with host	IEA	biological_process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	IEA	biological_process
GO:0045084	positive regulation of in terleukin-12 biosynthetic process	IEA	biological_process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IEA	biological_process
GO:0045410	positive regulation of in terleukin-6 biosynthetic process	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0048304	positive regulation of is otype switching to IgG is otypes	IEA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050718	positive regulation of in terleukin-1 beta secretio n	IEA	biological_process
GO:0050776	regulation of immune resp onse	IEA	biological_process
GO:0050796	regulation of insulin sec retion	IDA	biological_process
GO:0050852	T cell receptor signaling pathway	IEA	biological_process
GO:0050954	sensory perception of mec hanical stimulus	IEA	biological_process
GO:0051044	positive regulation of me mbrane protein ectodomain proteolysis	IDA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0051607	defense response to virus	IEA	biological_process
GO:0051712	positive regulation of ki lling of cells of other o rganism	IDA	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological_process
GO:0060550	positive regulation of fr uctose 1,6-bisphosphate 1 -phosphatase activity	IDA	biological_process
GO:0060552	positive regulation of fr uctose 1,6-bisphosphate m etabolic process	IDA	biological_process
GO:0060557	positive regulation of vi tamin D biosynthetic proc ess	IDA	biological_process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071351	cellular response to inte rleukin-18	IEA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0098908	regulation of neuronal ac tion potential	IEA	biological_process
GO:1903543	positive regulation of ex osomal secretion	IDA	biological_process
GO:2000309	positive regulation of tu mor necrosis factor (liga nd) superfamily member 11 production	IDA	biological_process
GO:2000345	regulation of hepatocyte proliferation	IEA	biological_process
GO:0000060	protein import into nucle us, translocation	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0002250	adaptive immune response	IBA	biological_process
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005133	interferon-gamma receptor binding	TAS	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IBA	cellular_component
GO:0006915	apoptotic process	IGI	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0006959	humoral immune response	IBA	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	ISS	biological_process
GO:0009615	response to virus	IDA	biological_process
GO:0010508	positive regulation of au tophagy	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IDA	biological_process
GO:0010634	positive regulation of ep ithelial cell migration	IDA	biological_process
GO:0030857	negative regulation of ep ithelial cell differentia tion	ISS	biological_process
GO:0032700	negative regulation of in terleukin-17 production	IDA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological_process
GO:0032735	positive regulation of in terleukin-12 production	IDA	biological_process
GO:0032747	positive regulation of in terleukin-23 production	IDA	biological_process
GO:0032834	positive regulation of CD 4-positive, CD25-positive , alpha-beta regulatory T cell differentiation inv olved in immune response	IDA	biological_process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	IDA	biological_process
GO:0033141	positive regulation of pe ptidyl-serine phosphoryla tion of STAT protein	NAS	biological_process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	IDA	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological_process
GO:0042511	positive regulation of ty rosine phosphorylation of Stat1 protein	IDA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050796	regulation of insulin sec retion	IDA	biological_process
GO:0051044	positive regulation of me mbrane protein ectodomain proteolysis	IDA	biological_process
GO:0051712	positive regulation of ki lling of cells of other o rganism	IDA	biological_process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological_process
GO:0060334	regulation of interferon- gamma-mediated signaling pathway	TAS	biological_process
GO:0060550	positive regulation of fr uctose 1,6-bisphosphate 1 -phosphatase activity	IDA	biological_process
GO:0060552	positive regulation of fr uctose 1,6-bisphosphate m etabolic process	IDA	biological_process
GO:0060557	positive regulation of vi tamin D biosynthetic proc ess	IDA	biological_process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:1903543	positive regulation of ex osomal secretion	IDA	biological_process
GO:2000309	positive regulation of tu mor necrosis factor (liga nd) superfamily member 11 production	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05164  Influenza A
hsa04630  Jak-STAT signaling pathway
hsa05145  Toxoplasmosis
hsa04659  Th17 cell differentiation
hsa05142  Chagas disease
hsa05162  Measles
hsa04657  IL-17 signaling pathway
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04066  HIF-1 signaling pathway
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa05146  Amoebiasis
hsa04660  T cell receptor signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05140  Leishmaniasis
hsa04217  Necroptosis
hsa04612  Antigen processing and presentation
hsa04350  TGF-beta signaling pathway
hsa05132  Salmonella infection
hsa05144  Malaria
hsa05332  Graft-versus-host disease
hsa05322  Systemic lupus erythematosus
hsa05330  Allograft rejection
hsa04940  Type I diabetes mellitus
hsa05143  African trypanosomiasis
hsa03050  Proteasome

Diseases

Associated diseases	References
Adenomyosis	PMID: 12069392
Allergic rhinitis	PMID: 15120189
Allergies	PMID: 11354638
Alzheimer's disease	PMID: 15679925
Anemia	PMID: 18426658
Aplastic anemia	KEGG: H01132,OMIM: 147570
Arthritis	PMID: 11981324
Asthma	PMID: 11240951
Atopy	PMID: 15007355
Behcet's disease	PMID: 19796538
Bronchiectasis	PMID: 17026468
Bullous pemphigoid	PMID: 16403098
Cancer	PMID: 19959217
Cardiovascular disease	PMID: 20061995
Celiac disease	PMID: 15215891
Chronic fatigue syndrome	PMID: 16762155
Clonorchiasis	PMID: 19488421
Connective tissue diseases	PMID: 19527514
Dermatitis	PMID: 16681592
Diabetes	PMID: 17498265
Endometrial cancer	PMID: 21872231
Endometrial polyposis	PMID: 21872231
Endometriosis	PMID: 11776169
Female infertility	PMID: 26114934
Female infertility	PMID: 7500318
Graves disease	PMID: 15068623
Idiopathic inflammatory myopathies	PMID: 17405833
Implantation failure	PMID: 12615834
Inflammatory bowel disease	PMID: 15842590
Juvenile arthritis	PMID: 15170937
Kidney disease	PMID: 18627514
Leiomyoma	PMID: 14597251
Liver disease	PMID: 15078471
Lymphocytosis	PMID: 18361934
Male infertility	PMID: 19811461
Mood disorders	PMID: 19890236
Multiple sclerosis	PMID: 16183136
Myasthenia gravis	PMID: 17509455
Nephropathy	PMID: 16493441
Omenn syndrome	PMID: 17572155
Osteolysis	PMID: 19860911
Pancreatitis	PMID: 15841043
Panencephalitis	PMID: 12020266
Parkinson's disease	PMID: 18568448
Pemphigus	PMID: 19470040
Periodontitis	PMID: 17209781
Polycystic ovary syndrome (PCOS)	PMID: 26751822
Preeclampsia	PMID: 24931237
Polycystic ovary syndrome (PCOS)	INFBASE22007253
Polycystic ovary syndrome (PCOS)	INFBASE22007253
Polycystic ovary syndrome (PCOS)	INFBASE22007253
Polycystic ovary syndrome (PCOS)	INFBASE22007253
Ovarian cancer	INFBASE17707463
Endometriosis associated infertility	INFBASE11526787
Endometriosis	INFBASE7906125
Preterm delivery	PMID: 17145371
Psoriasis	PMID: 11298547
Recurrent miscarriage	PMID: 26368793
Reproductive failure	PMID: 12607776
Rheumatoid arthritis	PMID: 15018649
Sarcoidosis	PMID: 15004750
Severe Acute Respiratory Syndrome	PMID: 19258635
Sjogren's syndrome	PMID: 14872501
Sudden infant death syndrome (SIDS)	PMID: 16916659
Systemic lupus erythematosus	PMID: 11528517
Systemic scleroderma	PMID: 18576303
Unexplained infertility	PMID: 24368037
Uveitis	PMID: 16024856
Vitiligo	PMID: 18820938
Wegener granulomatosis	PMID: 15708894

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
7978933	Endometrio sis					IFN gamma CD45 CD3 CD11c	Show abstract
7906125	Endometrio sis			33 (16 biopsies of ectopic end ometrium, 9 nor mal proliferati ve endometria, 8 secretory end ometria )		IFN gamma	Show abstract
24495049	Endometrio sis			49 (21 women wi th endometriosi s undergoing la paroscopic surg ery, 20 control s without endom etriosis)		NKp46 TNF-alpha and IFN-gamma	Show abstract
21477169	Endometrio sis	(CA)(n) repeat polymorphism	Korean	1064 (622 women with endometri osis, 442 wome n without endom etriosis)			Show abstract
15166131	Endometrio sis	IL-4 -590C/T, IFNG CA-repeat polymorphism	Japanes e	361 (185 patien ts with endomet riosis, 176 hea lthy fertile wo men)		IFNG IL-4	Show abstract
11776169	Endometrio sis			45 (30 EM patie nts, 15 normal controls)		IFN-gamma IL-4	Show abstract
20666952	Endometrio sis	CA-repeat polymorphism	South I ndian				Show abstract
17531990	Endometrio sis		Japanes e	129 (64 Japanes e endometriosis patients, 65 w omen with other laparoscopic d iagnoses)	Female infertility	HLA-ABC HLA-DR IFN-gamma	Show abstract
17234676	Endometrio sis			98 with and wit hout endometrio sis		IFN-gamma IL-10 IL-4 IL-2	Show abstract
11526787	Endometrio sis			19 (9 infertile women with min imal or mild en dometriosis and 10 patients wi th tubal occlus ion (the refere nce group))	Female infertility	TNF-alpha IFN-gamma	Show abstract
17707463	Endometrio sis			26 (12 ovarian carcinomas, 8 e ndometriosis, 6 normal ovaries )		IL-8 ENA-78 GRO-alpha I-TAC Mig SDF-1 CXCR2 CXCR3 and CXCR4	Show abstract
22007253	Endometrio sis			156 women under going in vitro fertilization ( IVF)	Female infertility	IL-1 IL-6 IL-18 IFN-gamma TNF-alpha IL-12 IL-23 MIP-1? MIP-1? MCP-1 RANTES IL-8 CD47	Show abstract
17706208	Endometrio sis			141 (63 women w ith II-IV endom etriosis, 78 co ntrols)		MIF MCP-1 INFG LEP CA-127	Show abstract
17582674	Endometrio sis					IL-6 MCP-1 INF-gamma VEGF TNF-alpha GM-CSF IL-2 IL-8 IL-15	Show abstract
15212674	Endometrio sis			8 women with mo derate to sever e stages of end ometriosis			Show abstract
17959888	Endometrio sis			3 patients with endometriosis		NK zeta NK IFN	Show abstract
28433374	Endometrio sis			107 female infe rtility	Female infertility		Show abstract