Endometriosis Knowledgebase

Search Result

Gene id

3479

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IGF1 Gene UCSC Ensembl

Aliases

IGF-I, IGFI, MGF

Gene name

insulin like growth factor 1

Alternate names

insulin-like growth factor I, insulin-like growth factor 1 (somatomedin C), insulin-like growth factor IB, mechano growth factor, somatomedin-C,

Gene location

12q23.2 (102481838: 102395866) Exons: 7 NC_000012.12

Gene summary(Entrez)

The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015]

OMIM

147440

Protein Summary

Protein general information

P05019

Name: Insulin like growth factor I (IGF I) (Mechano growth factor) (MGF) (Somatomedin C)

Length: 195 Mass: 21,841

Sequence

MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNK
PTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRK
GWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK

Structural information

Interpro:	IPR022341 IPR016179 IPR022350 IPR022353 IPR022352
Prosite:	PS00262
Pfam:	PF00049
PDB:	1B9G 1BQT 1GF1 1GZR 1GZY 1GZZ 1H02 1H59 1IMX 1PMX 1TGR 1WQJ 2DSP 2DSQ 2DSR 2GF1 3GF1 3LRI 4XSS
PDBsum:	1B9G 1BQT 1GF1 1GZR 1GZY 1GZZ 1H02 1H59 1IMX 1PMX 1TGR 1WQJ 2DSP 2DSQ 2DSR 2GF1 3GF1 3LRI 4XSS
DIP:	41933 6021
MINT:	204184
STRING:	ENSP00000302665;

Other Databases

GeneCards: IGF1; Malacards: IGF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000187	activation of MAPK activi ty	IMP	biological_process
GO:0001501	skeletal system developme nt	TAS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001775	cell activation	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005158	insulin receptor binding	IPI	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IMP	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IDA	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IMP	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IPI	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005179	hormone activity	IDA	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005614	interstitial matrix	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006417	regulation of translation	IEA	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007265	Ras protein signal transd uction	TAS	biological_process
GO:0007517	muscle organ development	TAS	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0007613	memory	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008283	cell proliferation	IMP	biological_process
GO:0008283	cell proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009408	response to heat	IDA	biological_process
GO:0009441	glycolate metabolic proce ss	TAS	biological_process
GO:0010468	regulation of gene expres sion	IMP	biological_process
GO:0010560	positive regulation of gl ycoprotein biosynthetic p rocess	IMP	biological_process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	IDA	biological_process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	IMP	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014834	skeletal muscle satellite cell maintenance involve d in skeletal muscle rege neration	IDA	biological_process
GO:0014896	muscle hypertrophy	IMP	biological_process
GO:0014904	myotube cell development	IDA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016942	insulin-like growth facto r binding protein complex	IC	cellular_component
GO:0030166	proteoglycan biosynthetic process	IDA	biological_process
GO:0030166	proteoglycan biosynthetic process	IMP	biological_process
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0031000	response to caffeine	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0032148	activation of protein kin ase B activity	IMP	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IDA	biological_process
GO:0034392	negative regulation of sm ooth muscle cell apoptoti c process	IDA	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035630	bone mineralization invol ved in bone maturation	IDA	biological_process
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0040014	regulation of multicellul ar organism growth	IEP	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042523	positive regulation of ty rosine phosphorylation of Stat5 protein	IDA	biological_process
GO:0042567	insulin-like growth facto r ternary complex	IDA	cellular_component
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045445	myoblast differentiation	IDA	biological_process
GO:0045600	positive regulation of fa t cell differentiation	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	IDA	biological_process
GO:0045740	positive regulation of DN A replication	ISS	biological_process
GO:0045740	positive regulation of DN A replication	IDA	biological_process
GO:0045740	positive regulation of DN A replication	IDA	biological_process
GO:0045821	positive regulation of gl ycolytic process	IDA	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046326	positive regulation of gl ucose import	IDA	biological_process
GO:0046579	positive regulation of Ra s protein signal transduc tion	IDA	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IMP	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IMP	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	IDA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	IMP	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050974	detection of mechanical s timulus involved in senso ry perception	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051450	myoblast proliferation	IDA	biological_process
GO:0051924	regulation of calcium ion transport	IEA	biological_process
GO:0060283	negative regulation of oo cyte development	IMP	biological_process
GO:0070371	ERK1 and ERK2 cascade	IMP	biological_process
GO:0070382	exocytic vesicle	ISS	cellular_component
GO:0070886	positive regulation of ca lcineurin-NFAT signaling cascade	IDA	biological_process
GO:0071257	cellular response to elec trical stimulus	IEA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IEA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	ISS	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:1904075	positive regulation of tr ophectodermal cell prolif eration	IMP	biological_process
GO:1904193	negative regulation of ch olangiocyte apoptotic pro cess	IEA	biological_process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IDA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IDA	biological_process
GO:0000187	activation of MAPK activi ty	IMP	biological_process
GO:0001501	skeletal system developme nt	TAS	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001775	cell activation	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005158	insulin receptor binding	IPI	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IEA	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IMP	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IDA	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IMP	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IPI	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IDA	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005496	steroid binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005614	interstitial matrix	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006417	regulation of translation	IEA	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007265	Ras protein signal transd uction	TAS	biological_process
GO:0007517	muscle organ development	TAS	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0007613	memory	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008283	cell proliferation	IMP	biological_process
GO:0008283	cell proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009408	response to heat	IDA	biological_process
GO:0009441	glycolate metabolic proce ss	TAS	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010468	regulation of gene expres sion	IMP	biological_process
GO:0010560	positive regulation of gl ycoprotein biosynthetic p rocess	IMP	biological_process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	IDA	biological_process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	IMP	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014834	skeletal muscle satellite cell maintenance involve d in skeletal muscle rege neration	IDA	biological_process
GO:0014896	muscle hypertrophy	IMP	biological_process
GO:0014904	myotube cell development	IDA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016942	insulin-like growth facto r binding protein complex	IC	cellular_component
GO:0030166	proteoglycan biosynthetic process	IDA	biological_process
GO:0030166	proteoglycan biosynthetic process	IMP	biological_process
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0031000	response to caffeine	IEA	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0032148	activation of protein kin ase B activity	IMP	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032869	cellular response to insu lin stimulus	IEA	biological_process
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IDA	biological_process
GO:0034392	negative regulation of sm ooth muscle cell apoptoti c process	IDA	biological_process
GO:0035094	response to nicotine	IEA	biological_process
GO:0035630	bone mineralization invol ved in bone maturation	IDA	biological_process
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0040014	regulation of multicellul ar organism growth	IEP	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042523	positive regulation of ty rosine phosphorylation of Stat5 protein	IDA	biological_process
GO:0042567	insulin-like growth facto r ternary complex	IDA	cellular_component
GO:0043025	neuronal cell body	IEA	cellular_component
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045445	myoblast differentiation	IDA	biological_process
GO:0045600	positive regulation of fa t cell differentiation	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	IDA	biological_process
GO:0045740	positive regulation of DN A replication	ISS	biological_process
GO:0045740	positive regulation of DN A replication	IDA	biological_process
GO:0045740	positive regulation of DN A replication	IDA	biological_process
GO:0045821	positive regulation of gl ycolytic process	IDA	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046326	positive regulation of gl ucose import	IDA	biological_process
GO:0046579	positive regulation of Ra s protein signal transduc tion	IDA	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IEA	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IMP	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IMP	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	IDA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0048545	response to steroid hormo ne	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	IMP	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0050974	detection of mechanical s timulus involved in senso ry perception	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051450	myoblast proliferation	IDA	biological_process
GO:0051924	regulation of calcium ion transport	IEA	biological_process
GO:0060283	negative regulation of oo cyte development	IMP	biological_process
GO:0070371	ERK1 and ERK2 cascade	IMP	biological_process
GO:0070382	exocytic vesicle	ISS	cellular_component
GO:0070886	positive regulation of ca lcineurin-NFAT signaling cascade	IDA	biological_process
GO:0071257	cellular response to elec trical stimulus	IEA	biological_process
GO:0071392	cellular response to estr adiol stimulus	IEA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	ISS	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:1904075	positive regulation of tr ophectodermal cell prolif eration	IMP	biological_process
GO:1904193	negative regulation of ch olangiocyte apoptotic pro cess	IEA	biological_process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IDA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IDA	biological_process
GO:0000187	activation of MAPK activi ty	IMP	biological_process
GO:0001501	skeletal system developme nt	TAS	biological_process
GO:0001775	cell activation	IDA	biological_process
GO:0002576	platelet degranulation	TAS	biological_process
GO:0005158	insulin receptor binding	IPI	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IMP	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IDA	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IMP	molecular_function
GO:0005159	insulin-like growth facto r receptor binding	IPI	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005178	integrin binding	IDA	molecular_function
GO:0005179	hormone activity	IDA	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006260	DNA replication	TAS	biological_process
GO:0006928	movement of cell or subce llular component	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007265	Ras protein signal transd uction	TAS	biological_process
GO:0007517	muscle organ development	TAS	biological_process
GO:0008283	cell proliferation	IMP	biological_process
GO:0008283	cell proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009408	response to heat	IDA	biological_process
GO:0009441	glycolate metabolic proce ss	TAS	biological_process
GO:0010468	regulation of gene expres sion	IMP	biological_process
GO:0010560	positive regulation of gl ycoprotein biosynthetic p rocess	IMP	biological_process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	IDA	biological_process
GO:0010613	positive regulation of ca rdiac muscle hypertrophy	IMP	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IMP	biological_process
GO:0014068	positive regulation of ph osphatidylinositol 3-kina se signaling	IDA	biological_process
GO:0014834	skeletal muscle satellite cell maintenance involve d in skeletal muscle rege neration	IDA	biological_process
GO:0014896	muscle hypertrophy	IMP	biological_process
GO:0014904	myotube cell development	IDA	biological_process
GO:0014911	positive regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016942	insulin-like growth facto r binding protein complex	IC	cellular_component
GO:0030166	proteoglycan biosynthetic process	IDA	biological_process
GO:0030166	proteoglycan biosynthetic process	IMP	biological_process
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0031093	platelet alpha granule lu men	TAS	cellular_component
GO:0032148	activation of protein kin ase B activity	IMP	biological_process
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IDA	biological_process
GO:0034392	negative regulation of sm ooth muscle cell apoptoti c process	IDA	biological_process
GO:0035630	bone mineralization invol ved in bone maturation	IDA	biological_process
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0040014	regulation of multicellul ar organism growth	IEP	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042523	positive regulation of ty rosine phosphorylation of Stat5 protein	IDA	biological_process
GO:0042567	insulin-like growth facto r ternary complex	IDA	cellular_component
GO:0043066	negative regulation of ap optotic process	IMP	biological_process
GO:0043388	positive regulation of DN A binding	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045445	myoblast differentiation	IDA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	IDA	biological_process
GO:0045725	positive regulation of gl ycogen biosynthetic proce ss	IDA	biological_process
GO:0045740	positive regulation of DN A replication	ISS	biological_process
GO:0045740	positive regulation of DN A replication	IDA	biological_process
GO:0045740	positive regulation of DN A replication	IDA	biological_process
GO:0045821	positive regulation of gl ycolytic process	IDA	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046326	positive regulation of gl ucose import	IDA	biological_process
GO:0046579	positive regulation of Ra s protein signal transduc tion	IDA	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IMP	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IMP	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	IDA	biological_process
GO:0048146	positive regulation of fi broblast proliferation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IDA	biological_process
GO:0050714	positive regulation of pr otein secretion	IMP	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050821	protein stabilization	IMP	biological_process
GO:0051450	myoblast proliferation	IDA	biological_process
GO:0060283	negative regulation of oo cyte development	IMP	biological_process
GO:0070371	ERK1 and ERK2 cascade	IMP	biological_process
GO:0070382	exocytic vesicle	ISS	cellular_component
GO:0070886	positive regulation of ca lcineurin-NFAT signaling cascade	IDA	biological_process
GO:0090201	negative regulation of re lease of cytochrome c fro m mitochondria	ISS	biological_process
GO:1904075	positive regulation of tr ophectodermal cell prolif eration	IMP	biological_process
GO:2000679	positive regulation of tr anscription regulatory re gion DNA binding	IDA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa05224  Breast cancer
hsa04068  FoxO signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04066  HIF-1 signaling pathway
hsa05218  Melanoma
hsa04152  AMPK signaling pathway
hsa04150  mTOR signaling pathway
hsa04211  Longevity regulating pathway
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04115  p53 signaling pathway
hsa04213  Longevity regulating pathway
hsa05214  Glioma
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
hsa04114  Oocyte meiosis
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04730  Long-term depression
hsa04960  Aldosterone-regulated sodium reabsorption

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Autism	PMID: 19598235
Cancer	PMID: 16322331
Chronic endometritis	PMID: 23351011
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Connective tissue diseases	PMID: 19527514
Diabetes	PMID: 12086966
Diabetic retinopathy	PMID: 16873705
Endometriosis	PMID: 26121987
Fetal growth retardation	PMID: 19217707
Genital endometriosis	PMID: 16758620
Gonadal dysgenesis	PMID: 4039732
Gynecomastia	PMID: 26287961
Hyperandrogenism	PMID: 23147876
Hypertension	PMID: 15726267
Hypogonadism	PMID: 17167799
Insulin resistance	PMID: 19680783
Laron dwarfism	PMID: 2567724
Male infertility	PMID: 10100482
Malignant pleural mesothelioma	KEGG: H00015
Microalbuminuria	PMID: 16645019
Microalbuminuria	PMID: 17218729
Oocyte maturation	PMID: 22532606
Osteoarthritis	PMID: 15082485
Osteoporosis	PMID: 15049048
Pituitary dwarfism	KEGG: H00254
Polycystic ovary syndrome (PCOS)	PMID: 26802879
Preeclampsia	PMID: 17179726
Endometriosis	INFBASE26899323
Genital endometriosis	INFBASE16758620
Endometriosis associated infertility	INFBASE10785227
Premature ovarian failure(POF)	PMID: 9286728
Primary biliary cirrhosis	PMID: 15049048
Scoliosis	PMID: 19634821
Short stature	PMID: 14714750
Thyroid diseases	PMID: 19064126

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17308170	Endometrio sis			IGF-1	Show abstract
26121987	Endometrio sis	925 (310 premen opausal women w ith incident en dometriosis, 61 5 matched contr ols)		IGF-1 IGFBP-3	Show abstract
10360259	Endometrio sis	44 (29 patients with endometri osis (15 in sta ge I & II endom etriosis, 14 st ages III & IV e ndometriosis), 15 controls)		IGFI IGFII IGFBP3	Show abstract
10785227	Endometrio sis	63 (43 with end ometriosis, 20 patients withou t endometriosis )	Female infertility	IGF-I IGF-II IGFBP-1 IGFBP-3 IGFBP-4	Show abstract
9049281	Endometrio sis	18 infertile pa tients for the problem of infe rtility		IGF-I IGF-IR	Show abstract
16758620	Genital en dometriosi s			IL-1beta IL-6 IGF-1	Show abstract
26899323	Endometrio sis	24 (12 endometr iosis, 12 contr ols)			Show abstract