Endometriosis Knowledgebase

Search Result

Gene id

3480

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IGF1R Gene UCSC Ensembl

Aliases

CD221, IGFIR, IGFR, JTK13

Gene name

insulin like growth factor 1 receptor

Alternate names

insulin-like growth factor 1 receptor, IGF-I receptor, soluble IGF1R variant 1, soluble IGF1R variant 2,

Gene location

15q26.3 (98648538: 98964529) Exons: 25 NC_000015.10

Gene summary(Entrez)

This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014]

OMIM

147370

Protein Summary

Protein general information

P08069

Name: Insulin like growth factor 1 receptor (EC 2.7.10.1) (Insulin like growth factor I receptor) (IGF I receptor) (CD antigen CD221) [Cleaved into: Insulin like growth factor 1 receptor alpha chain; Insulin like growth factor 1 receptor beta chain]

Length: 1367 Mass: 154,793

Tissue specificity: Found as a hybrid receptor with INSR in muscle, heart, kidney, adipose tissue, skeletal muscle, hepatoma, fibroblasts, spleen and placenta (at protein level). Expressed in a variety of tissues. Overexpressed in tumors, including melano

Sequence

MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRF
PKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLC
YLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACT
ENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELE
NFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAF
NPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTV
YYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYAD
GTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTM
SSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFART
MPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYAS
VNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE
ASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAY
LNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFR
EVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMN
GGRKNERALPLPQSSTC

Structural information

Protein Domains	Fibronectin (491-609) Fibronectin (610-708) Fibronectin (735-828) (834-927)
Motifs	IRS1- and(977-980)
Interpro:	IPR003961 IPR006211 IPR006212 IPR009030 IPR013783 IPR011009 IPR032675 IPR000719 IPR017441 IPR000494 IPR001245 IPR008266 IPR020635 IPR016246 IPR002011
Prosite:	PS50853 PS00107 PS50011 PS00109 PS00239
Pfam:	PF00757 PF07714 PF01030
CDD:	cd00063
PDB:	1IGR 1JQH 1K3A 1M7N 1P4O 2OJ9 2ZM3 3D94 3F5P 3I81 3LVP 3LW0 3NW5 3NW6 3NW7 3O23 3QQU 4D2R 4XSS 5FXQ 5FXR 5FXS 5HZN
PDBsum:	1IGR 1JQH 1K3A 1M7N 1P4O 2OJ9 2ZM3 3D94 3F5P 3I81 3LVP 3LW0 3NW5 3NW6 3NW7 3O23 3QQU 4D2R 4XSS 5FXQ 5FXR 5FXS 5HZN
DIP:	476
MINT:	85902
STRING:	ENSP00000268035;

Other Databases

GeneCards: IGF1R; Malacards: IGF1R

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IMP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005010	insulin-like growth facto r-activated receptor acti vity	IDA	molecular_function
GO:0005158	insulin receptor binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	IDA	molecular_function
GO:0005520	insulin-like growth facto r binding	IDA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005886	plasma membrane	ISS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IC	cellular_component
GO:0006955	immune response	IMP	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0008286	insulin receptor signalin g pathway	TAS	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IC	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IPI	molecular_function
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0038083	peptidyl-tyrosine autopho sphorylation	IMP	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043235	receptor complex	IDA	cellular_component
GO:0043548	phosphatidylinositol 3-ki nase binding	IPI	molecular_function
GO:0043559	insulin binding	IPI	molecular_function
GO:0043560	insulin receptor substrat e binding	IPI	molecular_function
GO:0045740	positive regulation of DN A replication	IMP	biological_process
GO:0046328	regulation of JNK cascade	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IDA	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	IDA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051389	inactivation of MAPKK act ivity	IDA	biological_process
GO:0000166	nucleotide binding	IEA	molecular_function
GO:0004672	protein kinase activity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IEA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IMP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0004714	transmembrane receptor pr otein tyrosine kinase act ivity	IEA	molecular_function
GO:0005010	insulin-like growth facto r-activated receptor acti vity	TAS	molecular_function
GO:0005010	insulin-like growth facto r-activated receptor acti vity	IDA	molecular_function
GO:0005158	insulin receptor binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	IDA	molecular_function
GO:0005520	insulin-like growth facto r binding	IDA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005524	ATP binding	IEA	molecular_function
GO:0005886	plasma membrane	ISS	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IC	cellular_component
GO:0006468	protein phosphorylation	IEA	biological_process
GO:0006955	immune response	IMP	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007169	transmembrane receptor pr otein tyrosine kinase sig naling pathway	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0008286	insulin receptor signalin g pathway	TAS	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IC	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016301	kinase activity	IEA	molecular_function
GO:0016310	phosphorylation	IEA	biological_process
GO:0016740	transferase activity	IEA	molecular_function
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IPI	molecular_function
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0038083	peptidyl-tyrosine autopho sphorylation	IMP	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043235	receptor complex	IDA	cellular_component
GO:0043548	phosphatidylinositol 3-ki nase binding	IEA	molecular_function
GO:0043548	phosphatidylinositol 3-ki nase binding	IPI	molecular_function
GO:0043559	insulin binding	IPI	molecular_function
GO:0043560	insulin receptor substrat e binding	IEA	molecular_function
GO:0043560	insulin receptor substrat e binding	IPI	molecular_function
GO:0045740	positive regulation of DN A replication	IMP	biological_process
GO:0046328	regulation of JNK cascade	IDA	biological_process
GO:0046777	protein autophosphorylati on	IEA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IDA	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	IDA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051389	inactivation of MAPKK act ivity	IDA	biological_process
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IMP	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	IDA	molecular_function
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005010	insulin-like growth facto r-activated receptor acti vity	TAS	molecular_function
GO:0005010	insulin-like growth facto r-activated receptor acti vity	IDA	molecular_function
GO:0005158	insulin receptor binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	IDA	molecular_function
GO:0005520	insulin-like growth facto r binding	IDA	molecular_function
GO:0005886	plasma membrane	ISS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	IC	cellular_component
GO:0006955	immune response	IMP	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0008286	insulin receptor signalin g pathway	TAS	biological_process
GO:0014065	phosphatidylinositol 3-ki nase signaling	IC	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0030335	positive regulation of ce ll migration	IMP	biological_process
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IPI	molecular_function
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0038083	peptidyl-tyrosine autopho sphorylation	IMP	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043231	intracellular membrane-bo unded organelle	IDA	cellular_component
GO:0043235	receptor complex	IDA	cellular_component
GO:0043548	phosphatidylinositol 3-ki nase binding	IPI	molecular_function
GO:0043559	insulin binding	IPI	molecular_function
GO:0043560	insulin receptor substrat e binding	IPI	molecular_function
GO:0045740	positive regulation of DN A replication	IMP	biological_process
GO:0046328	regulation of JNK cascade	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0046777	protein autophosphorylati on	IDA	biological_process
GO:0048009	insulin-like growth facto r receptor signaling path way	IDA	biological_process
GO:0048015	phosphatidylinositol-medi ated signaling	IDA	biological_process
GO:0051262	protein tetramerization	IDA	biological_process
GO:0051389	inactivation of MAPKK act ivity	IDA	biological_process

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa04014  Ras signaling pathway
hsa04510  Focal adhesion
hsa05224  Breast cancer
hsa04068  FoxO signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04144  Endocytosis
hsa05215  Prostate cancer
hsa01522  Endocrine resistance
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04066  HIF-1 signaling pathway
hsa05218  Melanoma
hsa04152  AMPK signaling pathway
hsa04150  mTOR signaling pathway
hsa04211  Longevity regulating pathway
hsa04520  Adherens junction
hsa04140  Autophagy - animal
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04213  Longevity regulating pathway
hsa05214  Glioma
hsa04114  Oocyte meiosis
hsa04730  Long-term depression

Diseases

Associated diseases	References
Adenomyosis	PMID: 9476071
Alzheimer's disease	PMID: 16983186
Asthenozoospermia	PMID: 26626315
Brain ischemia	PMID: 18477064
Cancer	PMID: 19950226
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Diabetes	PMID: 15127203
Embryo implantation	PMID: 12596304
Endometriosis	PMID: 9049281
Growth disorder	KEGG: H01274, OMIM: 147370
Human sperm capacitation	PMID: 15820831
Hyperandrogenism	PMID: 9302393
Diminished ovarian reserve (DOR)	PMID: 21846690
Malignant pleural mesothelioma	KEGG: H00015
Polycystic ovary syndrome (PCOS)	PMID: 22951915
Endometriosis	INFBASE9049281
Schizophrenia	PMID: 17044098
Spinal diseases	PMID: 18469701
Synovial sarcoma	KEGG: H00050
Unexplained infertility	PMID: 15130350

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
9049281	Endometrio sis			18 infertile pa tients for the problem of infe rtility		IGF-I IGF-IR	Show abstract