Endometriosis Knowledgebase

Search Result

Gene id

3485

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IGFBP2 Gene UCSC Ensembl

Aliases

IBP2, IGF-BP53

Gene name

insulin like growth factor binding protein 2

Alternate names

insulin-like growth factor-binding protein 2, IGF-binding protein 2, insulin-like growth factor binding protein 2, 36kDa,

Gene location

2q35 (216632827: 216664435) Exons: 6 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is one of six similar proteins that bind insulin-like growth factors I and II (IGF-I and IGF-II). The encoded protein can be secreted into the bloodstream, where it binds IGF-I and IGF-II with high affinity, or it can remain intracellular, interacting with many different ligands. High expression levels of this protein promote the growth of several types of tumors and may be predictive of the chances of recovery of the patient. Several transcript variants, one encoding a secreted isoform and the others encoding nonsecreted isoforms, have been found for this gene. [provided by RefSeq, Sep 2015]

OMIM

146731

Protein Summary

Protein general information

P18065

Name: Insulin like growth factor binding protein 2 (IBP 2) (IGF binding protein 2) (IGFBP 2)

Length: 325 Mass: 34,814

Sequence

MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAPPAAVAAVAGGARMPC
AELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYGASPEQVADNG
DDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPART
PCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI
RGDPECHLFYNEQQEARGVHTQRMQ

Structural information

Protein Domains	IGFBP (38-134) Thyroglobulin (224-306)
Motifs	Cell attachment(301-303)
Interpro:	IPR009030 IPR012210 IPR000867 IPR009168 IPR022321 IPR017891 IPR000716
Prosite:	PS00222 PS51323 PS00484 PS51162
Pfam:	PF00219 PF00086
PDB:	2H7T
PDBsum:	2H7T
STRING:	ENSP00000233809;

Other Databases

GeneCards: IGFBP2; Malacards: IGFBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	ISS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010226	response to lithium ion	IEA	biological_process
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0031995	insulin-like growth facto r II binding	ISS	molecular_function
GO:0031995	insulin-like growth facto r II binding	IBA	molecular_function
GO:0032355	response to estradiol	IEA	biological_process
GO:0032526	response to retinoic acid	IEA	biological_process
GO:0032870	cellular response to horm one stimulus	IEA	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	ISS	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	IBA	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	IC	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	IEA	molecular_function
GO:0005520	insulin-like growth facto r binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	ISS	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0007165	signal transduction	IEA	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0010226	response to lithium ion	IEA	biological_process
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0019838	growth factor binding	IEA	molecular_function
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031994	insulin-like growth facto r I binding	IEA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0031995	insulin-like growth facto r II binding	IEA	molecular_function
GO:0031995	insulin-like growth facto r II binding	ISS	molecular_function
GO:0031995	insulin-like growth facto r II binding	IBA	molecular_function
GO:0032355	response to estradiol	IEA	biological_process
GO:0032526	response to retinoic acid	IEA	biological_process
GO:0032870	cellular response to horm one stimulus	IEA	biological_process
GO:0040008	regulation of growth	IEA	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	ISS	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	IBA	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	IC	biological_process
GO:0043627	response to estrogen	IEA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0048545	response to steroid hormo ne	IEA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process
GO:0005102	receptor binding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	ISS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0031995	insulin-like growth facto r II binding	ISS	molecular_function
GO:0031995	insulin-like growth facto r II binding	IBA	molecular_function
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	ISS	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	IBA	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	IC	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0090090	negative regulation of ca nonical Wnt signaling pat hway	TAS	biological_process

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Cancer	PMID: 19692168
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Diabetes	PMID: 9166681
Endometriosis	PMID: 10785227
Female infertility	PMID: 16891052
Hyperandrogenism	PMID: 7525445
Polycystic ovary syndrome (PCOS)	PMID: 22951915
Endometriosis associated infertility	INFBASE10785227
Endometriosis	INFBASE10785227

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
10785227	Endometrio sis			63 (43 with end ometriosis, 20 patients withou t endometriosis )	Female infertility	IGF-I IGF-II IGFBP-1 IGFBP-3 IGFBP-4	Show abstract