Endometriosis Knowledgebase

Search Result

Gene id

3486

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IGFBP3 Gene UCSC Ensembl

Aliases

BP-53, IBP3

Gene name

insulin like growth factor binding protein 3

Alternate names

insulin-like growth factor-binding protein 3, IBP-3, IGF-binding protein 3, IGFBP-3, acid stable subunit of the 140 K IGF complex, binding protein 29, binding protein 53, growth hormone-dependent binding protein,

Gene location

7p12.3 (45921271: 45912244) Exons: 5 NC_000007.14

Gene summary(Entrez)

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

OMIM

146732

Protein Summary

Protein general information

P17936

Name: Insulin like growth factor binding protein 3 (IBP 3) (IGF binding protein 3) (IGFBP 3)

Length: 291 Mass: 31,674

Tissue specificity: Expressed by most tissues. Present in plasma.

Sequence

MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTCAL
SEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVE
SPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLK
FLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK

Structural information

Protein Domains	IGFBP (36-117) Thyroglobulin (210-285)
Interpro:	IPR009030 IPR012211 IPR000867 IPR009168 IPR022321 IPR017891 IPR000716
Prosite:	PS00222 PS51323 PS00484 PS51162
Pfam:	PF00219 PF00086
DIP:	40786
MINT:	142445
STRING:	ENSP00000370473;

Other Databases

GeneCards: IGFBP3; Malacards: IGFBP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IEA	biological_process
GO:0001933	negative regulation of pr otein phosphorylation	IDA	biological_process
GO:0001968	fibronectin binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	NAS	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0008160	protein tyrosine phosphat ase activator activity	IDA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IGI	biological_process
GO:0009968	negative regulation of si gnal transduction	NAS	biological_process
GO:0010906	regulation of glucose met abolic process	IEA	biological_process
GO:0014912	negative regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016942	insulin-like growth facto r binding protein complex	IC	cellular_component
GO:0031994	insulin-like growth facto r I binding	IPI	molecular_function
GO:0031995	insulin-like growth facto r II binding	IBA	molecular_function
GO:0042567	insulin-like growth facto r ternary complex	IDA	cellular_component
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	IBA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IEA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0044342	type B pancreatic cell pr oliferation	IEA	biological_process
GO:0045663	positive regulation of my oblast differentiation	IDA	biological_process
GO:0046872	metal ion binding	NAS	molecular_function
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IEA	biological_process
GO:0001933	negative regulation of pr otein phosphorylation	IDA	biological_process
GO:0001968	fibronectin binding	IEA	molecular_function
GO:0001968	fibronectin binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	IEA	molecular_function
GO:0005520	insulin-like growth facto r binding	IEA	molecular_function
GO:0005520	insulin-like growth facto r binding	NAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0006915	apoptotic process	IEA	biological_process
GO:0008160	protein tyrosine phosphat ase activator activity	IDA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IGI	biological_process
GO:0009968	negative regulation of si gnal transduction	NAS	biological_process
GO:0010906	regulation of glucose met abolic process	IEA	biological_process
GO:0014912	negative regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016942	insulin-like growth facto r binding protein complex	IC	cellular_component
GO:0019838	growth factor binding	IEA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IPI	molecular_function
GO:0031995	insulin-like growth facto r II binding	IBA	molecular_function
GO:0040008	regulation of growth	IEA	biological_process
GO:0042567	insulin-like growth facto r ternary complex	IDA	cellular_component
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043085	positive regulation of ca talytic activity	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	IBA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IEA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0044342	type B pancreatic cell pr oliferation	IEA	biological_process
GO:0045663	positive regulation of my oblast differentiation	IDA	biological_process
GO:0046872	metal ion binding	NAS	molecular_function
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0001933	negative regulation of pr otein phosphorylation	IDA	biological_process
GO:0001968	fibronectin binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	NAS	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0006468	protein phosphorylation	IDA	biological_process
GO:0008160	protein tyrosine phosphat ase activator activity	IDA	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IGI	biological_process
GO:0009968	negative regulation of si gnal transduction	NAS	biological_process
GO:0014912	negative regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016942	insulin-like growth facto r binding protein complex	IC	cellular_component
GO:0031994	insulin-like growth facto r I binding	IPI	molecular_function
GO:0031995	insulin-like growth facto r II binding	IBA	molecular_function
GO:0042567	insulin-like growth facto r ternary complex	IDA	cellular_component
GO:0042981	regulation of apoptotic p rocess	TAS	biological_process
GO:0043065	positive regulation of ap optotic process	IMP	biological_process
GO:0043567	regulation of insulin-lik e growth factor receptor signaling pathway	IBA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0045663	positive regulation of my oblast differentiation	IDA	biological_process
GO:0046872	metal ion binding	NAS	molecular_function
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa05202 Transcriptional misregulation in cancer
hsa04115 p53 signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Brain ischemia	PMID: 18624627
Cancer	PMID: 14693733
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Connective tissue diseases	PMID: 19527514
Endometriosis	PMID: 10785227
Female infertility	PMID: 16047582
Fetal growth retardation	PMID: 19217707
Growth disorder	PMID: 18984657
Hyperandrogenism	PMID: 9848301
Polycystic ovary syndrome (PCOS)	PMID: 20452586
Endometriosis associated infertility	INFBASE10785227
Endometriosis	INFBASE8921126
Schizophrenia	PMID: 17044098
Thyroid diseases	PMID: 19064126

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22381038	Endometrio sis	-672A>G, -202A>C and c.95C>G polymorphisms	Korean	236 (128 women with endometrio sis, 108 normal control women)		IGFBP3	Show abstract
14644829	Endometrio sis					uPA IGFBP-3	Show abstract
26121987	Endometrio sis			925 (310 premen opausal women w ith incident en dometriosis, 61 5 matched contr ols)		IGF-1 IGFBP-3	Show abstract
8921126	Endometrio sis			36 (26 patients with minimal a nd mild endomet riosism, 10 con trols)			Show abstract
10785227	Endometrio sis			63 (43 with end ometriosis, 20 patients withou t endometriosis )	Female infertility	IGF-I IGF-II IGFBP-1 IGFBP-3 IGFBP-4	Show abstract