Endometriosis Knowledgebase

Search Result

Gene id

3488

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IGFBP5 Gene UCSC Ensembl

Aliases

IBP5

Gene name

insulin like growth factor binding protein 5

Alternate names

insulin-like growth factor-binding protein 5, IBP-5, IGF-binding protein 5, IGFBP-5,

Gene location

2q35 (216695548: 216672104) Exons: 4 NC_000002.12

OMIM

146734

Protein Summary

Protein general information

P24593

Name: Insulin like growth factor binding protein 5 (IBP 5) (IGF binding protein 5) (IGFBP 5)

Length: 272 Mass: 30,570

Tissue specificity: Osteosarcoma, and at lower levels in liver, kidney and brain.

Sequence

MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCALAEGQSCGVYTERCA
QGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHEEPTTSEMAEETYSPKIFRPKHTRISELKAE
AVKKDRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFY
KRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE

Structural information

Protein Domains	IGFBP (23-103) Thyroglobulin (189-263)
Interpro:	IPR009030 IPR012213 IPR000867 IPR009168 IPR022321 IPR017891 IPR000716
Prosite:	PS00222 PS51323 PS00484 PS51162
Pfam:	PF00219 PF00086
PDB:	1BOE 1H59
PDBsum:	1BOE 1H59
DIP:	48433
MINT:	1378863
STRING:	ENSP00000233813;

Other Databases

GeneCards: IGFBP5; Malacards: IGFBP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IEA	biological_process
GO:0001968	fibronectin binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0006006	glucose metabolic process	IEA	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0010906	regulation of glucose met abolic process	IEA	biological_process
GO:0014912	negative regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016942	insulin-like growth facto r binding protein complex	IC	cellular_component
GO:0017148	negative regulation of tr anslation	IDA	biological_process
GO:0030336	negative regulation of ce ll migration	IDA	biological_process
GO:0031069	hair follicle morphogenes is	IEA	biological_process
GO:0031994	insulin-like growth facto r I binding	IPI	molecular_function
GO:0031995	insulin-like growth facto r II binding	IBA	molecular_function
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0042567	insulin-like growth facto r ternary complex	IDA	cellular_component
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IEA	biological_process
GO:0043569	negative regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0044342	type B pancreatic cell pr oliferation	IEA	biological_process
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0045926	negative regulation of gr owth	IEA	biological_process
GO:0048286	lung alveolus development	IEA	biological_process
GO:0048630	skeletal muscle tissue gr owth	IEA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0051146	striated muscle cell diff erentiation	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0060056	mammary gland involution	IEA	biological_process
GO:0060416	response to growth hormon e	ISS	biological_process
GO:0071320	cellular response to cAMP	IDA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:1901862	negative regulation of mu scle tissue development	IEA	biological_process
GO:1904205	negative regulation of sk eletal muscle hypertrophy	IEA	biological_process
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0001649	osteoblast differentiatio n	IEA	biological_process
GO:0001968	fibronectin binding	IEA	molecular_function
GO:0001968	fibronectin binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	IEA	molecular_function
GO:0005520	insulin-like growth facto r binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0006006	glucose metabolic process	IEA	biological_process
GO:0007165	signal transduction	NAS	biological_process
GO:0007565	female pregnancy	IEA	biological_process
GO:0010906	regulation of glucose met abolic process	IEA	biological_process
GO:0014912	negative regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016942	insulin-like growth facto r binding protein complex	IC	cellular_component
GO:0017148	negative regulation of tr anslation	IDA	biological_process
GO:0019838	growth factor binding	IEA	molecular_function
GO:0030336	negative regulation of ce ll migration	IDA	biological_process
GO:0031069	hair follicle morphogenes is	IEA	biological_process
GO:0031994	insulin-like growth facto r I binding	IPI	molecular_function
GO:0031995	insulin-like growth facto r II binding	IBA	molecular_function
GO:0035556	intracellular signal tran sduction	IEA	biological_process
GO:0040008	regulation of growth	IEA	biological_process
GO:0042567	insulin-like growth facto r ternary complex	IDA	cellular_component
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0043568	positive regulation of in sulin-like growth factor receptor signaling pathwa y	IEA	biological_process
GO:0043569	negative regulation of in sulin-like growth factor receptor signaling pathwa y	IEA	biological_process
GO:0043569	negative regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0044342	type B pancreatic cell pr oliferation	IEA	biological_process
GO:0045668	negative regulation of os teoblast differentiation	IEA	biological_process
GO:0045926	negative regulation of gr owth	IEA	biological_process
GO:0048286	lung alveolus development	IEA	biological_process
GO:0048630	skeletal muscle tissue gr owth	IEA	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0051146	striated muscle cell diff erentiation	IEA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0060056	mammary gland involution	IEA	biological_process
GO:0060416	response to growth hormon e	ISS	biological_process
GO:0071320	cellular response to cAMP	IDA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:1901862	negative regulation of mu scle tissue development	IEA	biological_process
GO:1904205	negative regulation of sk eletal muscle hypertrophy	IEA	biological_process
GO:0001968	fibronectin binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0007165	signal transduction	NAS	biological_process
GO:0014912	negative regulation of sm ooth muscle cell migratio n	IDA	biological_process
GO:0016942	insulin-like growth facto r binding protein complex	IC	cellular_component
GO:0017148	negative regulation of tr anslation	IDA	biological_process
GO:0030336	negative regulation of ce ll migration	IDA	biological_process
GO:0031994	insulin-like growth facto r I binding	IPI	molecular_function
GO:0031995	insulin-like growth facto r II binding	IBA	molecular_function
GO:0042567	insulin-like growth facto r ternary complex	IDA	cellular_component
GO:0043569	negative regulation of in sulin-like growth factor receptor signaling pathwa y	IDA	biological_process
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0060416	response to growth hormon e	ISS	biological_process
GO:0071320	cellular response to cAMP	IDA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Cancer	PMID: 19692168
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Diabetes	PMID: 9166681
Endometriosis	PMID: 16249290
Polycystic ovary syndrome (PCOS)	PMID: 7515389
Endometriosis	INFBASE16249290

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16249290	Endometrio sis			30 (15 patients undergoing lap aroscopy or hys terectomy for e ndometriosis, 1 5 controls)		IGFBP5 PIM2 RPL41 PSAP FBLN1 SIPL DLX5 HSD11B2 SET and RHOE	Show abstract