Endometriosis Knowledgebase

Search Result

Gene id

3490

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IGFBP7 Gene UCSC Ensembl

Aliases

AGM, FSTL2, IBP-7, IGFBP-7, IGFBP-7v, IGFBPRP1, MAC25, PSF, RAMSVPS, TAF

Gene name

insulin like growth factor binding protein 7

Alternate names

insulin-like growth factor-binding protein 7, IGF-binding protein 7, IGFBP-rP1, PGI2-stimulating factor, angiomodulin, prostacyclin-stimulating factor, tumor-derived adhesion factor,

Gene location

4q12 (57110384: 57031070) Exons: 5 NC_000004.12

Gene summary(Entrez)

This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm (PMID:21835307). [provided by RefSeq, Dec 2011]

OMIM

602867

Protein Summary

Protein general information

Q16270

Name: Insulin like growth factor binding protein 7 (IBP 7) (IGF binding protein 7) (IGFBP 7) (IGFBP rP1) (MAC25 protein) (PGI2 stimulating factor) (Prostacyclin stimulating factor) (Tumor derived adhesion factor) (TAF)

Length: 282 Mass: 29,130

Sequence

MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGG
AGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQ
VSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPE
KHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Structural information

Protein Domains	IGFBP (28-106) Kazal-like. (105-158) Ig-like (160-264)
Interpro:	IPR009030 IPR007110 IPR013783 IPR013098 IPR003599 IPR000867 IPR011390 IPR002350
Prosite:	PS50835 PS51323 PS51465
Pfam:	PF07679 PF00219 PF07648
MINT:	7006618
STRING:	ENSP00000295666;

Other Databases

GeneCards: IGFBP7; Malacards: IGFBP7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	IEA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0001558	regulation of cell growth	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005520	insulin-like growth facto r binding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0019838	growth factor binding	IEA	molecular_function
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0031012	extracellular matrix	IDA	cellular_component

Diseases

Associated diseases	References
Cancer	PMID: 9627112
Diabetes	PMID: 19019211
Endometrial cancer	PMID: 24972190
Endometriosis	PMID: 19019211
Osteoarthritis	PMID: 15708897
Diabetis mellitus	INFBASE19019211
Endometriosis	INFBASE19019211
Retinal arterial macroaneurysm	OMIM: 602867

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19019211	Endometrio sis						Show abstract