Endometriosis Knowledgebase

Search Result

Gene id

354

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

KLK3 Gene UCSC Ensembl

Aliases

APS, KLK2A1, PSA, hK3

Gene name

kallikrein related peptidase 3

Alternate names

prostate-specific antigen, P-30 antigen, gamma-seminoprotein, kallikrein-3, semenogelase, seminin,

Gene location

19q13.33 (50854914: 50860763) Exons: 5 NC_000019.10

Gene summary(Entrez)

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Its protein product is a protease present in seminal plasma. It is thought to function normally in the liquefaction of seminal coagulum, presumably by hydrolysis of the high molecular mass seminal vesicle protein. Serum level of this protein, called PSA in the clinical setting, is useful in the diagnosis and monitoring of prostatic carcinoma. Alternate splicing of this gene generates several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

OMIM

176820

Protein Summary

Protein general information

P07288

Name: Prostate specific antigen (PSA) (EC 3.4.21.77) (Gamma seminoprotein) (Seminin) (Kallikrein 3) (P 30 antigen) (Semenogelase)

Length: 261 Mass: 28,741

Sequence

MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILL
GRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGT
TCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQG
ITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Structural information

Protein Domains	Peptidase (25-258)
Interpro:	IPR009003 IPR001314 IPR001254 IPR018114 IPR033116
Prosite:	PS50240 PS00134 PS00135
Pfam:	PF00089
CDD:	cd00190
PDB:	1PFA 2PSA 2ZCH 2ZCK 2ZCL 3QUM
PDBsum:	1PFA 2PSA 2ZCH 2ZCK 2ZCL 3QUM
STRING:	ENSP00000314151;

Other Databases

GeneCards: KLK3; Malacards: KLK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002778	antibacterial peptide pro duction	IDA	biological_process
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004252	serine-type endopeptidase activity	IMP	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0006508	proteolysis	IMP	biological_process
GO:0008236	serine-type peptidase act ivity	TAS	molecular_function
GO:0016525	negative regulation of an giogenesis	NAS	biological_process
GO:0016811	hydrolase activity, actin g on carbon-nitrogen (but not peptide) bonds, in l inear amides	IMP	molecular_function
GO:0043234	protein complex	IDA	cellular_component
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0002778	antibacterial peptide pro duction	IDA	biological_process
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004252	serine-type endopeptidase activity	IEA	molecular_function
GO:0004252	serine-type endopeptidase activity	IMP	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IEA	biological_process
GO:0006508	proteolysis	IMP	biological_process
GO:0008233	peptidase activity	IEA	molecular_function
GO:0008236	serine-type peptidase act ivity	IEA	molecular_function
GO:0008236	serine-type peptidase act ivity	TAS	molecular_function
GO:0016525	negative regulation of an giogenesis	NAS	biological_process
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0016811	hydrolase activity, actin g on carbon-nitrogen (but not peptide) bonds, in l inear amides	IMP	molecular_function
GO:0043234	protein complex	IDA	cellular_component
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0002778	antibacterial peptide pro duction	IDA	biological_process
GO:0004175	endopeptidase activity	IDA	molecular_function
GO:0004252	serine-type endopeptidase activity	IMP	molecular_function
GO:0004252	serine-type endopeptidase activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0006508	proteolysis	IMP	biological_process
GO:0008236	serine-type peptidase act ivity	TAS	molecular_function
GO:0016525	negative regulation of an giogenesis	NAS	biological_process
GO:0016811	hydrolase activity, actin g on carbon-nitrogen (but not peptide) bonds, in l inear amides	IMP	molecular_function
GO:0043234	protein complex	IDA	cellular_component
GO:0044267	cellular protein metaboli c process	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa05200 Pathways in cancer
hsa05215 Prostate cancer

Diseases

Associated diseases	References
Azoospermia	PMID: 22182811
Cancer	PMID: 11299734
Endometriosis	PMID: 25134292
Female infertility	PMID: 24280142
Male infertility	PMID: 1897760
Oligoasthenozoospermia	PMID: 8867597
Oligozoospermia	PMID: 22182811
Endometriosis	INFBASE25134292
Polycystic ovary syndrome (PCOS)	PMID: 11297583
Premature ovarian failure ( POF)	PMID: 24103315

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
25134292	Endometrio sis						Show abstract