Endometriosis Knowledgebase

Search Result

Gene id

3553

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL1B Gene UCSC Ensembl

Aliases

IL-1, IL1-BETA, IL1F2

Gene name

interleukin 1 beta

Alternate names

interleukin-1 beta, IL-1 beta, catabolin, preinterleukin 1 beta, pro-interleukin-1-beta,

Gene location

2q14.1 (112836841: 112829757) Exons: 7 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2008]

OMIM

147720

Protein Summary

Protein general information

P01584

Name: Interleukin 1 beta (IL 1 beta) (Catabolin)

Length: 269 Mass: 30,748

Tissue specificity: Expressed in activated monocytes/macrophages (at protein level). {ECO

Sequence

MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLR
KMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQ
DMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNK
LEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Structural information

Interpro:	IPR003296 IPR020877 IPR000975 IPR003502 IPR008996
Prosite:	PS00253
Pfam:	PF00340 PF02394
PDB:	1HIB 1I1B 1IOB 1ITB 1L2H 1S0L 1T4Q 1TOO 1TP0 1TWE 1TWM 21BI 2I1B 2KH2 2NVH 31BI 3LTQ 3O4O 3POK 41BI 4DEP 4G6J 4G6M 4GAF 4GAI 4I1B 5BVP 5I1B 5MVZ 6I1B 7I1B 9ILB
PDBsum:	1HIB 1I1B 1IOB 1ITB 1L2H 1S0L 1T4Q 1TOO 1TP0 1TWE 1TWM 21BI 2I1B 2KH2 2NVH 31BI 3LTQ 3O4O 3POK 41BI 4DEP 4G6J 4G6M 4GAF 4GAI 4I1B 5BVP 5I1B 5MVZ 6I1B 7I1B 9ILB
DIP:	474
MINT:	189806
STRING:	ENSP00000263341;

Other Databases

GeneCards: IL1B; Malacards: IL1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0000187	activation of MAPK activi ty	IDA	biological_process
GO:0001660	fever generation	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	NAS	biological_process
GO:0002439	chronic inflammatory resp onse to antigenic stimulu s	IEA	biological_process
GO:0002711	positive regulation of T cell mediated immunity	IC	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IMP	molecular_function
GO:0005149	interleukin-1 receptor bi nding	IBA	molecular_function
GO:0005149	interleukin-1 receptor bi nding	NAS	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IMP	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005776	autophagosome	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006144	purine nucleobase metabol ic process	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006954	inflammatory response	NAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007566	embryo implantation	TAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007613	memory	IEA	biological_process
GO:0008210	estrogen metabolic proces s	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009100	glycoprotein metabolic pr ocess	IEA	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0010193	response to ozone	IEA	biological_process
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	ISS	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010829	negative regulation of gl ucose transport	ISS	biological_process
GO:0014050	negative regulation of gl utamate secretion	IEA	biological_process
GO:0014805	smooth muscle adaptation	NAS	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019742	pentacyclic triterpenoid metabolic process	IEA	biological_process
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0030141	secretory granule	IEA	cellular_component
GO:0030213	hyaluronan biosynthetic p rocess	IDA	biological_process
GO:0030593	neutrophil chemotaxis	IEA	biological_process
GO:0030638	polyketide metabolic proc ess	IEA	biological_process
GO:0030728	ovulation	IEA	biological_process
GO:0030730	sequestering of triglycer ide	IDA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IC	biological_process
GO:0031622	positive regulation of fe ver generation	ISS	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0032308	positive regulation of pr ostaglandin secretion	ISS	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032611	interleukin-1 beta produc tion	IEA	biological_process
GO:0032725	positive regulation of gr anulocyte macrophage colo ny-stimulating factor pro duction	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	TAS	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0033092	positive regulation of im mature T cell proliferati on in thymus	IEA	biological_process
GO:0033129	positive regulation of hi stone phosphorylation	NAS	biological_process
GO:0033198	response to ATP	IEA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0033591	response to L-ascorbic ac id	IEA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	NAS	biological_process
GO:0035066	positive regulation of hi stone acetylation	NAS	biological_process
GO:0035176	social behavior	IEA	biological_process
GO:0035234	ectopic germ cell program med cell death	IEA	biological_process
GO:0035505	positive regulation of my osin light chain kinase a ctivity	IDA	biological_process
GO:0035634	response to stilbenoid	IEA	biological_process
GO:0035690	cellular response to drug	IDA	biological_process
GO:0036270	response to diuretic	IEA	biological_process
GO:0036273	response to statin	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	IDA	biological_process
GO:0043278	response to morphine	IEA	biological_process
GO:0043407	negative regulation of MA P kinase activity	ISS	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043507	positive regulation of JU N kinase activity	IEA	biological_process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	IEA	biological_process
GO:0045086	positive regulation of in terleukin-2 biosynthetic process	IMP	biological_process
GO:0045410	positive regulation of in terleukin-6 biosynthetic process	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	ISS	biological_process
GO:0045833	negative regulation of li pid metabolic process	ISS	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046330	positive regulation of JN K cascade	IBA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	ISS	biological_process
GO:0046827	positive regulation of pr otein export from nucleus	NAS	biological_process
GO:0048711	positive regulation of as trocyte differentiation	IEA	biological_process
GO:0050766	positive regulation of ph agocytosis	IMP	biological_process
GO:0050796	regulation of insulin sec retion	IDA	biological_process
GO:0050995	negative regulation of li pid catabolic process	IDA	biological_process
GO:0050996	positive regulation of li pid catabolic process	ISS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	IDA	biological_process
GO:0051044	positive regulation of me mbrane protein ectodomain proteolysis	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0060355	positive regulation of ce ll adhesion molecule prod uction	NAS	biological_process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological_process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological_process
GO:0070062	extracellular exosome	IEA	cellular_component
GO:0070164	negative regulation of ad iponectin secretion	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070487	monocyte aggregation	IDA	biological_process
GO:0071236	cellular response to anti biotic	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEP	biological_process
GO:0071310	cellular response to orga nic substance	IDA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071398	cellular response to fatt y acid	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071414	cellular response to meth otrexate	IEA	biological_process
GO:0071548	response to dexamethasone	IEA	biological_process
GO:0071639	positive regulation of mo nocyte chemotactic protei n-1 production	IDA	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:1903140	regulation of establishme nt of endothelial barrier	IDA	biological_process
GO:2000173	negative regulation of br anching morphogenesis of a nerve	IEA	biological_process
GO:2000178	negative regulation of ne ural precursor cell proli feration	IEA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IEA	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IDA	biological_process
GO:0000122	negative regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0000187	activation of MAPK activi ty	IDA	biological_process
GO:0001660	fever generation	IEA	biological_process
GO:0001660	fever generation	IEA	biological_process
GO:0001666	response to hypoxia	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	NAS	biological_process
GO:0002439	chronic inflammatory resp onse to antigenic stimulu s	IEA	biological_process
GO:0002711	positive regulation of T cell mediated immunity	IC	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IMP	molecular_function
GO:0005149	interleukin-1 receptor bi nding	IEA	molecular_function
GO:0005149	interleukin-1 receptor bi nding	IBA	molecular_function
GO:0005149	interleukin-1 receptor bi nding	NAS	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IMP	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005764	lysosome	IEA	cellular_component
GO:0005776	autophagosome	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006144	purine nucleobase metabol ic process	IEA	biological_process
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006954	inflammatory response	NAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007566	embryo implantation	TAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0007584	response to nutrient	IEA	biological_process
GO:0007611	learning or memory	IEA	biological_process
GO:0007613	memory	IEA	biological_process
GO:0008210	estrogen metabolic proces s	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0009100	glycoprotein metabolic pr ocess	IEA	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0009743	response to carbohydrate	IEA	biological_process
GO:0010193	response to ozone	IEA	biological_process
GO:0010243	response to organonitroge n compound	IEA	biological_process
GO:0010332	response to gamma radiati on	IEA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IEA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	ISS	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010629	negative regulation of ge ne expression	IEA	biological_process
GO:0010829	negative regulation of gl ucose transport	IEA	biological_process
GO:0010829	negative regulation of gl ucose transport	ISS	biological_process
GO:0010942	positive regulation of ce ll death	IEA	biological_process
GO:0014050	negative regulation of gl utamate secretion	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0014805	smooth muscle adaptation	NAS	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019742	pentacyclic triterpenoid metabolic process	IEA	biological_process
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0030141	secretory granule	IEA	cellular_component
GO:0030213	hyaluronan biosynthetic p rocess	IDA	biological_process
GO:0030593	neutrophil chemotaxis	IEA	biological_process
GO:0030638	polyketide metabolic proc ess	IEA	biological_process
GO:0030728	ovulation	IEA	biological_process
GO:0030730	sequestering of triglycer ide	IDA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IC	biological_process
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031622	positive regulation of fe ver generation	IEA	biological_process
GO:0031622	positive regulation of fe ver generation	ISS	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0031982	vesicle	IEA	cellular_component
GO:0032308	positive regulation of pr ostaglandin secretion	IEA	biological_process
GO:0032308	positive regulation of pr ostaglandin secretion	ISS	biological_process
GO:0032355	response to estradiol	IEA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032611	interleukin-1 beta produc tion	IEA	biological_process
GO:0032725	positive regulation of gr anulocyte macrophage colo ny-stimulating factor pro duction	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IEA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	TAS	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0032874	positive regulation of st ress-activated MAPK casca de	IEA	biological_process
GO:0033092	positive regulation of im mature T cell proliferati on in thymus	IEA	biological_process
GO:0033129	positive regulation of hi stone phosphorylation	NAS	biological_process
GO:0033198	response to ATP	IEA	biological_process
GO:0033280	response to vitamin D	IEA	biological_process
GO:0033591	response to L-ascorbic ac id	IEA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	NAS	biological_process
GO:0035066	positive regulation of hi stone acetylation	NAS	biological_process
GO:0035176	social behavior	IEA	biological_process
GO:0035234	ectopic germ cell program med cell death	IEA	biological_process
GO:0035505	positive regulation of my osin light chain kinase a ctivity	IDA	biological_process
GO:0035634	response to stilbenoid	IEA	biological_process
GO:0035690	cellular response to drug	IDA	biological_process
GO:0036270	response to diuretic	IEA	biological_process
GO:0036273	response to statin	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IEA	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	IDA	biological_process
GO:0043123	positive regulation of I- kappaB kinase/NF-kappaB s ignaling	IEA	biological_process
GO:0043278	response to morphine	IEA	biological_process
GO:0043407	negative regulation of MA P kinase activity	IEA	biological_process
GO:0043407	negative regulation of MA P kinase activity	ISS	biological_process
GO:0043434	response to peptide hormo ne	IEA	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0043507	positive regulation of JU N kinase activity	IEA	biological_process
GO:0045080	positive regulation of ch emokine biosynthetic proc ess	IEA	biological_process
GO:0045086	positive regulation of in terleukin-2 biosynthetic process	IMP	biological_process
GO:0045410	positive regulation of in terleukin-6 biosynthetic process	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological_process
GO:0045687	positive regulation of gl ial cell differentiation	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	ISS	biological_process
GO:0045833	negative regulation of li pid metabolic process	IEA	biological_process
GO:0045833	negative regulation of li pid metabolic process	ISS	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046330	positive regulation of JN K cascade	IEA	biological_process
GO:0046330	positive regulation of JN K cascade	IBA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	IEA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	ISS	biological_process
GO:0046827	positive regulation of pr otein export from nucleus	NAS	biological_process
GO:0048711	positive regulation of as trocyte differentiation	IEA	biological_process
GO:0050766	positive regulation of ph agocytosis	IMP	biological_process
GO:0050768	negative regulation of ne urogenesis	IEA	biological_process
GO:0050796	regulation of insulin sec retion	IDA	biological_process
GO:0050900	leukocyte migration	IEA	biological_process
GO:0050995	negative regulation of li pid catabolic process	IDA	biological_process
GO:0050996	positive regulation of li pid catabolic process	IEA	biological_process
GO:0050996	positive regulation of li pid catabolic process	ISS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	IEA	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	IDA	biological_process
GO:0051044	positive regulation of me mbrane protein ectodomain proteolysis	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051781	positive regulation of ce ll division	IEA	biological_process
GO:0060355	positive regulation of ce ll adhesion molecule prod uction	NAS	biological_process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological_process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological_process
GO:0070062	extracellular exosome	IEA	cellular_component
GO:0070164	negative regulation of ad iponectin secretion	IEA	biological_process
GO:0070164	negative regulation of ad iponectin secretion	ISS	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0070487	monocyte aggregation	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071236	cellular response to anti biotic	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEP	biological_process
GO:0071310	cellular response to orga nic substance	IDA	biological_process
GO:0071333	cellular response to gluc ose stimulus	IEA	biological_process
GO:0071396	cellular response to lipi d	IEA	biological_process
GO:0071398	cellular response to fatt y acid	IEA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071414	cellular response to meth otrexate	IEA	biological_process
GO:0071548	response to dexamethasone	IEA	biological_process
GO:0071639	positive regulation of mo nocyte chemotactic protei n-1 production	IDA	biological_process
GO:0090023	positive regulation of ne utrophil chemotaxis	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:1903140	regulation of establishme nt of endothelial barrier	IDA	biological_process
GO:2000173	negative regulation of br anching morphogenesis of a nerve	IEA	biological_process
GO:2000178	negative regulation of ne ural precursor cell proli feration	IEA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IEA	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IDA	biological_process
GO:0000165	MAPK cascade	IMP	biological_process
GO:0000187	activation of MAPK activi ty	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IDA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	NAS	biological_process
GO:0002711	positive regulation of T cell mediated immunity	IC	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IMP	molecular_function
GO:0005149	interleukin-1 receptor bi nding	IBA	molecular_function
GO:0005149	interleukin-1 receptor bi nding	NAS	molecular_function
GO:0005576	extracellular region	NAS	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IMP	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0005829	cytosol	TAS	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006954	inflammatory response	NAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007566	embryo implantation	TAS	biological_process
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	ISS	biological_process
GO:0010575	positive regulation of va scular endothelial growth factor production	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010829	negative regulation of gl ucose transport	ISS	biological_process
GO:0014805	smooth muscle adaptation	NAS	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019904	protein domain specific b inding	IPI	molecular_function
GO:0030213	hyaluronan biosynthetic p rocess	IDA	biological_process
GO:0030730	sequestering of triglycer ide	IDA	biological_process
GO:0030949	positive regulation of va scular endothelial growth factor receptor signalin g pathway	IC	biological_process
GO:0031622	positive regulation of fe ver generation	ISS	biological_process
GO:0031663	lipopolysaccharide-mediat ed signaling pathway	IDA	biological_process
GO:0032308	positive regulation of pr ostaglandin secretion	ISS	biological_process
GO:0032725	positive regulation of gr anulocyte macrophage colo ny-stimulating factor pro duction	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032755	positive regulation of in terleukin-6 production	TAS	biological_process
GO:0032757	positive regulation of in terleukin-8 production	IDA	biological_process
GO:0033129	positive regulation of hi stone phosphorylation	NAS	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	IDA	biological_process
GO:0034116	positive regulation of he terotypic cell-cell adhes ion	NAS	biological_process
GO:0035066	positive regulation of hi stone acetylation	NAS	biological_process
GO:0035505	positive regulation of my osin light chain kinase a ctivity	IDA	biological_process
GO:0035690	cellular response to drug	IDA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042346	positive regulation of NF -kappaB import into nucle us	IDA	biological_process
GO:0043122	regulation of I-kappaB ki nase/NF-kappaB signaling	IDA	biological_process
GO:0043407	negative regulation of MA P kinase activity	ISS	biological_process
GO:0043491	protein kinase B signalin g	IMP	biological_process
GO:0045086	positive regulation of in terleukin-2 biosynthetic process	IMP	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IDA	biological_process
GO:0045766	positive regulation of an giogenesis	ISS	biological_process
GO:0045833	negative regulation of li pid metabolic process	ISS	biological_process
GO:0045840	positive regulation of mi totic nuclear division	IMP	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046330	positive regulation of JN K cascade	IBA	biological_process
GO:0046627	negative regulation of in sulin receptor signaling pathway	ISS	biological_process
GO:0046827	positive regulation of pr otein export from nucleus	NAS	biological_process
GO:0050766	positive regulation of ph agocytosis	IMP	biological_process
GO:0050796	regulation of insulin sec retion	IDA	biological_process
GO:0050995	negative regulation of li pid catabolic process	IDA	biological_process
GO:0050996	positive regulation of li pid catabolic process	ISS	biological_process
GO:0050999	regulation of nitric-oxid e synthase activity	IDA	biological_process
GO:0051044	positive regulation of me mbrane protein ectodomain proteolysis	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0060355	positive regulation of ce ll adhesion molecule prod uction	NAS	biological_process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological_process
GO:0060559	positive regulation of ca lcidiol 1-monooxygenase a ctivity	IDA	biological_process
GO:0070164	negative regulation of ad iponectin secretion	ISS	biological_process
GO:0070487	monocyte aggregation	IDA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEP	biological_process
GO:0071310	cellular response to orga nic substance	IDA	biological_process
GO:0071407	cellular response to orga nic cyclic compound	IDA	biological_process
GO:0071639	positive regulation of mo nocyte chemotactic protei n-1 production	IDA	biological_process
GO:1903140	regulation of establishme nt of endothelial barrier	IDA	biological_process
GO:2001240	negative regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04010  MAPK signaling pathway
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05418  Fluid shear stress and atherosclerosis
hsa05164  Influenza A
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04621  NOD-like receptor signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa05142  Chagas disease
hsa05162  Measles
hsa04657  IL-17 signaling pathway
hsa04380  Osteoclast differentiation
hsa04932  Non-alcoholic fatty liver disease
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa04640  Hematopoietic cell lineage
hsa04620  Toll-like receptor signaling pathway
hsa05146  Amoebiasis
hsa05140  Leishmaniasis
hsa04217  Necroptosis
hsa05133  Pertussis
hsa04064  NF-kappa B signaling pathway
hsa05010  Alzheimer's disease
hsa05134  Legionellosis
hsa05132  Salmonella infection
hsa05144  Malaria
hsa05332  Graft-versus-host disease
hsa04940  Type I diabetes mellitus
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05143  African trypanosomiasis
hsa05020  Prion diseases
hsa04623  Cytosolic DNA-sensing pathway
hsa01523  Antifolate resistance

Diseases

Associated diseases	References
Acute pancreatitis	PMID: 19220961
Adenomyosis	PMID: 12069392
Aggressive periodontitis	PMID: 19892918
Alzheimer's disease	PMID: 15201366
Amyloidosis	PMID: 19026124
Ankylosing spondylitis	PMID: 19930406
Arthritis	PMID: 11981324
Asthenozoospermia	PMID: 24981555
Asthma	PMID: 15787640
Atopy	PMID: 12746420
Biliary atresia	PMID: 12100571
Bipolar disorder	PMID: 19125864
Celiac disease	PMID: 16078996
Cerebral palsy	PMID: 19238444
Chronic immune thrombocytopenic purpura	PMID: 15009068
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Chronic Periodontitis	PMID: 19336858
Connective tissue diseases	PMID: 19527514
Crohn's disease	PMID: 11686217
Cystic fibrosis	PMID: 19431193
Dementia	PMID: 19546559
Depression	PMID: 18728809
Dermatomyositis	PMID: 19035492
Diabetes	PMID: 19053923
Diabetic nephropathy	PMID: 10049523
Disorders of the endometrium	PMID: 16264101
Duodenal ulcer	PMID: 19804405
Dysthymia	PMID: 14997019
Endometrial cancer	PMID: 27770434
Endometriosis	PMID: 16758620
Epilepsy	PMID: 11422336
Epilepsy	PMID: 19066720
Febrile seizures	PMID: 19854014
Female infertility	PMID: 16433835
Gastric cancer	OMIM: 147720
Gastric disease	PMID: 19295440
Genital endometriosis	PMID: 16758620
Gential endometriosis	PMID: 16027877
Glomerulonephritis	PMID: 19280228
Graves disease	PMID: 19793334
Graves ophthalmopathy	PMID: 19274529
Hemophilia A	PMID: 16380445
Henoch-Schonlein purpura	PMID: 14760799
Hypospermatogenesis	PMID: 20188355
Impaired spermatogenesis	PMID: 17215863
Implantation failure	PMID: 12615834
Inflammatory bowel disease	PMID: 19643686
Irritable bowel syndrome	PMID: 19844779
Ischemic heart disease	PMID: 14707339
Juvenile arthritis	PMID: 12195624
Kawasaki disease	PMID: 15900570
Keratoconus	PMID: 19043479
Kidney disease	PMID: 19578796
Leiomyoma	PMID: 14597251
Lumbar spondylosis	PMID: 16362385
Male infertility	PMID: 8723440
Male infertility	PMID: 15595690
Migraine disorders	PMID: 19559392
Mood disorders	PMID: 18832862
Multiple sclerosis	PMID: 11498264
Myocardial infarction	PMID: 19811432
Nephropathy	PMID: 11849463
Obesity	PMID: 18465425
Oligozoospermia	PMID: 17341438
Osteoarthritis	PMID: 18392912
Osteolysis	PMID: 18821666
Ovarian hyperstimulation syndrome (OHSS)	PMID: 8671471
Ovarian hyperstimulation syndrome (OHSS)	PMID: 9093211
Pancreatitis	PMID: 18815552
Parkinson's disease	PMID: 15279067
Pelvic adhesions	PMID: 11756364
Pemphigus	PMID: 19470040
Periodontitis	PMID: 16304445
Polycystic ovary syndrome (PCOS)	PMID: 16965825
Polycystic ovaries (PCO)	PMID: 7593494
Endometriosis	INFBASE28074436
Endometriosis associated infertility	INFBASE21958553
Genital endometriosis	INFBASE16758620
External gential endometriosis	INFBASE16027877
Female infertility	INFBASE8607944
Premature birth	PMID: 19141488
Psoriasis	PMID: 16918024
Recurrent implantation failure (RIF)	PMID: 12615834
Recurrent miscarriage	PMID: 11756575
Restenosis	PMID: 12082592
Retinopathy	PMID: 18787502
Rheumatoid arthritis	PMID: 12115161
Rhinitis	PMID: 14533660
Sarcoidosis	PMID: 12039524
Schizophrenia	PMID: 18583979
Sertoli cell-only syndrome (SCOS)	PMID: 21235388
Silicosis	PMID: 18666137
Sleep apnea	PMID: 19218687
Spermatogenetic defects	PMID: 8723440
Spermatogenetic defects	PMID: 17335817
Spermatogenetic defects	PMID: 23869807
Spinal diseases	PMID: 18469698
Spondylitis	PMID: 18484691
Systemic lupus erythematosus	PMID: 15088297
Systemic sclerosis	KEGG: H01492
Temporal lobe epilepsy	PMID: 14510824
Thryoiditis	PMID: 11506478
Tubal factor infertility	PMID: 22007253
Ulcerative colitis	PMID: 12572877

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15483103	Endometrio sis					IL-1beta COX-2	Show abstract
1442940	Endometrio sis			50 (21 infertil e women with no endometriosis, 19 untreated e ndometriosis, 1 0 undergoing tr eatment for end ometriosis )	Female infertility, Endometriosis associated infertility	IL-1 TNF	Show abstract
26054109	Endometrio sis			98 (46 with end ometriosis, 52 with benign tum ors)		IL-1 TNF IgG IgA Bcl-6 Blimp-1	Show abstract
10597959	Endometrio sis			23 (10 patients with endometri osis, 13 withou t endometriosis )		TNFA IL-1	Show abstract
22509941	Endometrio sis	IL-1B (889C>T), IL-1 receptor antagonist (IL-1RA) 86-bp microsatellite, IL-1 receptor 1 (IL-1R1) ( 52C>A, 294C>T, 1498T>C, 1632A>G, IL-1R2 rs2072472 C>T and rs7561460 C>T)	Korean	352 (138 women with endometrio sis, 214 women without endomet riosis)		IL-1? IL-1RA IL-1R2	Show abstract
17997749	Endometrio sis					IL-1 MIF	Show abstract
11301163	Endometrio sis			51 (19 regularl y cycling women , 32 without en dometriosis)		MMP-3 IL-1 TIMP-1 TIMP-2 MMP 1 MMP 2 MMP 9	Show abstract
3493176	Endometrio sis			18 (11 patients with minimal o r mild endometr iosis, 7 women undergoing tuba l ligation)	Female infertility		Show abstract
17678915	Endometrio sis			35 (20 during l uteal phase, 15 during menustr ual phase were selected for th is study based on cycle phase and presence/ab sence of endome triosis )		alpha(V) integrin IL-1 beta MCP-1 RANTES VCAM-1	Show abstract
17482186	Endometrio sis					IL-1 beta IL-1RII	Show abstract
12840897	Endometrio sis			15 patients wit h endometriosis		IL-1 beta TNF-alpha MCP-1	Show abstract
8607944	Endometrio sis					IL-1 beta IL-2 and�TNF- alpha�	Show abstract
21958553	Endometrio sis				Female infertility	sIL1RAcP sIL1R2 IL1B	Show abstract
22888172	Endometrio sis					TSLP IL-1?	Show abstract
25063483	Endometrio sis			603 (510 women with histologic ally proven end ometriosis, 93 endometriosis-f ree controls)		IL-1? IL-1sRII	Show abstract
21640344	Endometrio sis					IL-1B	Show abstract
23269356	Endometrio sis			50 women includ ing EMS patient s undergoing la paroscopic ovar ian cystectomy, non-EMS patien ts undergoing h ysterectomy for uterine fibroi ds		hBD-2 TNFA IL-1b	Show abstract
17919610	Endometrio sis			222 (68 normal women as contro ls, 154 women w ith endometrios is)		IL1beta IL1R2�	Show abstract
16762180	Endometrio sis			55 (40 women wi th endometriosi s, 15 control w omen)		IL-1alpha IL-1beta	Show abstract
12372467	Endometrio sis					Tob-1 IL-1beta	Show abstract
22537218	Endometrio sis			85 women with a nd without endo metriosis		IL-1beta IL-18 and ICE	Show abstract
20137818	Endometrio sis					Bax VEGF IL-1beta	Show abstract
16027877	Gential en dometriosi s				Female infertility	IL-1beta IL-2 IL-6 TGFbeta VEGF	Show abstract
16758620	Genital en dometriosi s					IL-1beta IL-6 IGF-1	Show abstract
28074436	Endometrio sis			34 (17 patients with confirme d endometriosis , 17 age-matche d NC-IVF women without diagnos ed endometriosi s as controls)	Female infertility	IL6	Show abstract
27987338	Endometrio sis					IL4 VCL	Show abstract
27018977	Endometrio sis	IL1R2		110 (55 women w ith endometrios is, 55 women wi thout endometri osis)			Show abstract