Endometriosis Knowledgebase

Search Result

Gene id

3556

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL1RAP Gene UCSC Ensembl

Aliases

C3orf13, IL-1RAcP, IL1R3

Gene name

interleukin 1 receptor accessory protein

Alternate names

interleukin-1 receptor accessory protein, IL-1 receptor accessory protein, IL-1R3, interleukin-1 receptor 3, interleukin-1 receptor accessory protein beta,

Gene location

3q28 (190514050: 190657196) Exons: 16 NC_000003.12

Gene summary(Entrez)

Interleukin 1 induces synthesis of acute phase and proinflammatory proteins during infection, tissue damage, or stress, by forming a complex at the cell membrane with an interleukin 1 receptor and an accessory protein. This gene encodes the interleukin 1 receptor accessory protein. The protein is a necessary part of the interleukin 1 receptor complex which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in two transcript variants encoding two different isoforms, one membrane-bound and one soluble. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. [provided by RefSeq, Nov 2009]

OMIM

602626

Protein Summary

Protein general information

Q9NPH3

Name: Interleukin 1 receptor accessory protein (IL 1 receptor accessory protein) (IL 1RAcP) (Interleukin 1 receptor 3) (IL 1R 3) (IL 1R3)

Length: 570 Mass: 65,418

Tissue specificity: Detected in liver, skin, placenta, thymus and lung. Isoform 4 is predominantly expressed in brain. Overexpresed on candidate chronic myeloid leukemia (CML) stem cells, hematopoietic stem cells and mononuclear cells of patients with acu

Sequence

MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQ
DRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLY
IEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHL
TRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATVLLVVILI
VVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEFVLLTLRGVLENEFGYKLCIFDRDSLPGGIV
TDETLSFIQKSRRLLVVLSPNYVLQGTQALLELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIK
WKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQGLSYSSLKNV

Structural information

Protein Domains	Ig-like (21-128) Ig-like (141-230) Ig-like (242-348) TIR. (403-549)
Interpro:	IPR007110 IPR013783 IPR003599 IPR015621 IPR004074 IPR000157
Prosite:	PS50835 PS50104
Pfam:	PF01582
PDB:	3O4O 4DEP
PDBsum:	3O4O 4DEP
DIP:	33487
MINT:	1184198

Other Databases

GeneCards: IL1RAP; Malacards: IL1RAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004908	interleukin-1 receptor ac tivity	IEA	molecular_function
GO:0005149	interleukin-1 receptor bi nding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0045087	innate immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0004908	interleukin-1 receptor ac tivity	IEA	molecular_function
GO:0005149	interleukin-1 receptor bi nding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0043234	protein complex	IEA	cellular_component
GO:0045087	innate immune response	IEA	biological_process
GO:0004871	signal transducer activit y	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0016020	membrane	IDA	cellular_component

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04659  Th17 cell differentiation
hsa04750  Inflammatory mediator regulation of TRP channels

Diseases

Associated diseases	References
Cancer	PMID: 18385676
Celiac disease	PMID: 19240061
Connective tissue diseases	PMID: 19527514
Diabetes	PMID: 16519819
Endometriosis	PMID: 24935223
Endometriosis associated infertility	INFBASE21958553
Endometriosis	INFBASE21272866

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
21958553	Endometrio sis		Female infertility	sIL1RAcP sIL1R2 IL1B	Show abstract
21272866	Endometrio sis	120 (66 women w ith endometrios is, 60 healthy women with no l aparoscopic evi dence of endome triosis)		IL1RAcP	Show abstract
24935223	Endometrio sis	74 (47 women wi th endometriosi s, 27 controls)	Female infertility		Show abstract