Endometriosis Knowledgebase

Search Result

Gene id

3558

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL2 Gene UCSC Ensembl

Aliases

IL-2, TCGF, lymphokine

Gene name

interleukin 2

Alternate names

interleukin-2, T cell growth factor, aldesleukin, involved in regulation of T-cell clonal expansion,

Gene location

4q27 (122456494: 122449478) Exons: 5 NC_000004.12

Gene summary(Entrez)

The protein encoded by this gene is a secreted cytokine that is important for the proliferation of T and B lymphocytes. The receptor of this cytokine is a heterotrimeric protein complex whose gamma chain is also shared by interleukin 4 (IL4) and interleukin 7 (IL7). The expression of this gene in mature thymocytes is monoallelic, which represents an unusual regulatory mode for controlling the precise expression of a single gene. The targeted disruption of a similar gene in mice leads to ulcerative colitis-like disease, which suggests an essential role of this gene in the immune response to antigenic stimuli. [provided by RefSeq, Jul 2008]

OMIM

147680

Protein Summary

Protein general information

P60568

Name: Interleukin 2 (IL 2) (T cell growth factor) (TCGF) (Aldesleukin)

Length: 153 Mass: 17,628

Sequence

MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKH
LQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIIS
TLT

Structural information

Interpro:	IPR009079 IPR000779 IPR030477
Prosite:	PS00424
Pfam:	PF00715
PDB:	1ILM 1ILN 1IRL 1M47 1M48 1M49 1M4A 1M4B 1M4C 1NBP 1PW6 1PY2 1QVN 1Z92 2B5I 2ERJ 3INK 3QAZ 3QB1 4NEJ 4NEM 5LQB
PDBsum:	1ILM 1ILN 1IRL 1M47 1M48 1M49 1M4A 1M4B 1M4C 1NBP 1PW6 1PY2 1QVN 1Z92 2B5I 2ERJ 3INK 3QAZ 3QB1 4NEJ 4NEM 5LQB
DIP:	475
MINT:	1522299
STRING:	ENSP00000226730;

Other Databases

GeneCards: IL2; Malacards: IL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001933	negative regulation of pr otein phosphorylation	IEA	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological_process
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005134	interleukin-2 receptor bi nding	TAS	molecular_function
GO:0005134	interleukin-2 receptor bi nding	IDA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006955	immune response	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007205	protein kinase C-activati ng G-protein coupled rece ptor signaling pathway	IEA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0019209	kinase activator activity	TAS	molecular_function
GO:0030101	natural killer cell activ ation	TAS	biological_process
GO:0030217	T cell differentiation	TAS	biological_process
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0030307	positive regulation of ce ll growth	TAS	biological_process
GO:0030890	positive regulation of B cell proliferation	IDA	biological_process
GO:0031851	kappa-type opioid recepto r binding	IEA	molecular_function
GO:0032729	positive regulation of in terferon-gamma production	IEA	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IDA	biological_process
GO:0034105	positive regulation of ti ssue remodeling	IC	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042523	positive regulation of ty rosine phosphorylation of Stat5 protein	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043208	glycosphingolipid binding	IEA	molecular_function
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045591	positive regulation of re gulatory T cell different iation	IEA	biological_process
GO:0045822	negative regulation of he art contraction	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046013	regulation of T cell home ostatic proliferation	IEA	biological_process
GO:0048304	positive regulation of is otype switching to IgG is otypes	IEA	biological_process
GO:0050672	negative regulation of ly mphocyte proliferation	IEA	biological_process
GO:0050728	negative regulation of in flammatory response	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IEA	biological_process
GO:0060999	positive regulation of de ndritic spine development	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0001933	negative regulation of pr otein phosphorylation	IEA	biological_process
GO:0001934	positive regulation of pr otein phosphorylation	IEA	biological_process
GO:0002250	adaptive immune response	IEA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological_process
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005134	interleukin-2 receptor bi nding	IEA	molecular_function
GO:0005134	interleukin-2 receptor bi nding	IEA	molecular_function
GO:0005134	interleukin-2 receptor bi nding	TAS	molecular_function
GO:0005134	interleukin-2 receptor bi nding	IDA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005829	cytosol	IEA	cellular_component
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007204	positive regulation of cy tosolic calcium ion conce ntration	IEA	biological_process
GO:0007205	protein kinase C-activati ng G-protein coupled rece ptor signaling pathway	IEA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0019209	kinase activator activity	TAS	molecular_function
GO:0030101	natural killer cell activ ation	TAS	biological_process
GO:0030217	T cell differentiation	TAS	biological_process
GO:0030246	carbohydrate binding	IEA	molecular_function
GO:0030307	positive regulation of ce ll growth	TAS	biological_process
GO:0030890	positive regulation of B cell proliferation	IDA	biological_process
GO:0031851	kappa-type opioid recepto r binding	IEA	molecular_function
GO:0032729	positive regulation of in terferon-gamma production	IEA	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IDA	biological_process
GO:0034105	positive regulation of ti ssue remodeling	IC	biological_process
GO:0042102	positive regulation of T cell proliferation	IEA	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IEA	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042523	positive regulation of ty rosine phosphorylation of Stat5 protein	IEA	biological_process
GO:0042523	positive regulation of ty rosine phosphorylation of Stat5 protein	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0043208	glycosphingolipid binding	IEA	molecular_function
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045471	response to ethanol	IEA	biological_process
GO:0045582	positive regulation of T cell differentiation	IEA	biological_process
GO:0045591	positive regulation of re gulatory T cell different iation	IEA	biological_process
GO:0045822	negative regulation of he art contraction	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046013	regulation of T cell home ostatic proliferation	IEA	biological_process
GO:0048304	positive regulation of is otype switching to IgG is otypes	IEA	biological_process
GO:0050672	negative regulation of ly mphocyte proliferation	IEA	biological_process
GO:0050728	negative regulation of in flammatory response	IEA	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IEA	biological_process
GO:0060999	positive regulation of de ndritic spine development	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0002903	negative regulation of B cell apoptotic process	IDA	biological_process
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005134	interleukin-2 receptor bi nding	TAS	molecular_function
GO:0005134	interleukin-2 receptor bi nding	IDA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006955	immune response	TAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0019209	kinase activator activity	TAS	molecular_function
GO:0030101	natural killer cell activ ation	TAS	biological_process
GO:0030217	T cell differentiation	TAS	biological_process
GO:0030307	positive regulation of ce ll growth	TAS	biological_process
GO:0030890	positive regulation of B cell proliferation	IDA	biological_process
GO:0032740	positive regulation of in terleukin-17 production	IDA	biological_process
GO:0034105	positive regulation of ti ssue remodeling	IC	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042104	positive regulation of ac tivated T cell proliferat ion	IDA	biological_process
GO:0042523	positive regulation of ty rosine phosphorylation of Stat5 protein	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	TAS	biological_process
GO:0050729	positive regulation of in flammatory response	IC	biological_process

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa05166  HTLV-I infection
hsa04630  Jak-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05142  Chagas disease
hsa05162  Measles
hsa05321  Inflammatory bowel disease
hsa04660  T cell receptor signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05332  Graft-versus-host disease
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa04940  Type I diabetes mellitus
hsa04672  Intestinal immune network for IgA production
PTHR45426:SF1  Inflammation mediated by chemokine and cytokine signaling pathway

Diseases

Associated diseases	References
Addison's disease	PMID: 18593762
Aggressive periodontitis	PMID: 19892918
Allergic Rhinitis	PMID: 22036096
Alzheimer's disease	PMID: 19141999
Arthritis	PMID: 11315919
Asthma	PMID: 12392859
Atopy	PMID: 15005726
Cancer	PMID: 19773451
Celiac disease	PMID: 17558408
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Crohn's disease	PMID: 18942754
Cystic fibrosis	PMID: 17336597
Diabetes	KEGG: H00408
Endometrial cancer	PMID: 21718613
Endometriosis	PMID: 8607944
Gastric atrophy	PMID: 15904474
Gential endometriosis	PMID: 16027877
Graves disease	PMID: 19250279
Graves ophthalmopathy	PMID: 19798110
Implantation rate	PMID: 18331736
Inflammatory bowel disease	PMID: 19471255
Juvenile arthritis	PMID: 15170937
Kidney disease	PMID: 15104679
Leukocytospermia	PMID: 7789553
Male infertility	PMID: 8554429
Multiple sclerosis	PMID: 12409183
Osteolysis	PMID: 19860911
Ovarian hyperstimulation syndrome (OHSS)	PMID: 8752613
Parkinson's disease	PMID: 15120188
Pelvic endometriosis	PMID: 26871558
Pelvic endometriosis	PMID: 26871558
Pelvic endometriosis	PMID: 26871558
Pemphigus	PMID: 19470040
Periodontitis	PMID: 12354082
Polycystic ovary syndrome (PCOS)	PMID: 25303485
External gential endometriosis	INFBASE16027877
Female infertility	INFBASE10682450
Endometriosis	INFBASE10682450
Premature birth	PMID: 19141488
Pulmonary fibrosis	PMID: 16573560
Recurrent miscarriage	PMID: 22349103
Rheumatoid arthritis	PMID: 15895884
Schizophrenia	PMID: 16091861
Scleroderma	PMID: 18576303
Severe combined immunodeficiency	OMIM: 147680
Systemic lupus erythematosus	PMID: 18650128
Unexplained infertility	PMID: 12607776

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
17234676	Endometrio sis	98 with and wit hout endometrio sis		IFN-gamma IL-10 IL-4 IL-2	Show abstract
16027877	Endometrio sis (Genit al)		Female infertility	IL-1beta IL-2 IL-6 TGFbeta VEGF	Show abstract
10682450	Endometrio sis	28 (15 infertil e patients with endometriosis, 13 normal fert ile women as co ntrols)	Female infertility		Show abstract