Endometriosis Knowledgebase

Search Result

Gene id

3560

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL2RB Gene UCSC Ensembl

Aliases

CD122, IL15RB, P70-75

Gene name

interleukin 2 receptor subunit beta

Alternate names

interleukin-2 receptor subunit beta, CD122 antigen, IL-2 receptor subunit beta, IL-2R subunit beta, IL-2RB, high affinity IL-2 receptor beta subunit, high affinity IL-2 receptor subunit beta, interleukin 15 receptor, beta, interleukin 2 receptor, beta, p75,

Gene location

22q12.3 (37149921: 37125837) Exons: 10 NC_000022.11

Gene summary(Entrez)

The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein. The use of alternative promoters results in multiple transcript variants encoding the same protein. The protein is primarily expressed in the hematopoietic system. The use by some variants of an alternate promoter in an upstream long terminal repeat (LTR) results in placenta-specific expression. [provided by RefSeq, Sep 2016]

OMIM

146710

SNPs

rs228953

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000684.2   g.37135396G>A
NC_000022.10   g.37531436G>A
NC_000022.11   g.37135396G>A
NM_000878.3   c.750C>T
NM_000878.4   c.750C>T
NM_001346222.1   c.750C>T
NM_001346223.1   c.750C>T
NP_000869.1   p.Gly250=
NP_001333151.1   p.Gly250=
NP_001333152.1   p.Gly250=
XP_005261656.1   p.Gly250=

Protein Summary

Protein general information

P14784

Name: Interleukin 2 receptor subunit beta (IL 2 receptor subunit beta) (IL 2R subunit beta) (IL 2RB) (High affinity IL 2 receptor subunit beta) (p70 75) (p75) (CD antigen CD122)

Length: 551 Mass: 61,117

Sequence

MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCE
LLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMAIQDFKPFENLRLMAPISLQVVHVETHRCNI
SWEISQASHYFERHLEFEARTLSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQ
PLAFRTKPAALGKDTIPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFTNQGYFFFHLPDALEI
EACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCTFPSRDDLLLFSPSLLGGPSPPSTAPGGSGA
GEERMPPSLQERVPRDWDPQPLGPPTPGVPDLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRAL
NARLPLNTDAYLSLQELQGQDPTHLV

Structural information

Protein Domains	Fibronectin (134-234)
Motifs	WSXWS motif(220-224) Box 1(278-286)
Interpro:	IPR003961 IPR003531 IPR013783
Prosite:	PS50853 PS01355
CDD:	cd00063
PDB:	1ILM 1ILN 2B5I 2ERJ 3QAZ 4GS7
PDBsum:	1ILM 1ILN 2B5I 2ERJ 3QAZ 4GS7
DIP:	43
MINT:	273361
STRING:	ENSP00000216223;

Other Databases

GeneCards: IL2RB; Malacards: IL2RB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0004911	interleukin-2 receptor ac tivity	IDA	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0009897	external side of plasma m embrane	ISS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019976	interleukin-2 binding	ISS	molecular_function
GO:0030101	natural killer cell activ ation	IEA	biological_process
GO:0038110	interleukin-2-mediated si gnaling pathway	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0004911	interleukin-2 receptor ac tivity	TAS	molecular_function
GO:0000165	MAPK cascade	TAS	biological_process
GO:0004896	cytokine receptor activit y	IEA	molecular_function
GO:0004911	interleukin-2 receptor ac tivity	IEA	molecular_function
GO:0004911	interleukin-2 receptor ac tivity	IDA	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009897	external side of plasma m embrane	ISS	cellular_component
GO:0009986	cell surface	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019976	interleukin-2 binding	IEA	molecular_function
GO:0019976	interleukin-2 binding	ISS	molecular_function
GO:0030101	natural killer cell activ ation	IEA	biological_process
GO:0038110	interleukin-2-mediated si gnaling pathway	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0004911	interleukin-2 receptor ac tivity	TAS	molecular_function
GO:0000165	MAPK cascade	TAS	biological_process
GO:0004911	interleukin-2 receptor ac tivity	IDA	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006461	protein complex assembly	TAS	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0009897	external side of plasma m embrane	ISS	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019976	interleukin-2 binding	ISS	molecular_function
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0004911	interleukin-2 receptor ac tivity	TAS	molecular_function

KEGG pathways

hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa05166  HTLV-I infection
hsa04630  Jak-STAT signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa04659  Th17 cell differentiation
hsa04144  Endocytosis
hsa05162  Measles
hsa04658  Th1 and Th2 cell differentiation

Diseases

Associated diseases	References
Asthma	PMID: 20860503
Cancer	PMID: 19773451
Celiac disease	PMID: 19240061
Connective tissue diseases	PMID: 19527514
Diabetes	PMID: 21829393
Endometriosis	PMID: 16084898
Inflammatory bowel disease	PMID: 19471255
Parkinson's disease	PMID: 17052657
Endometriosis	INFBASE16084898
Rheumatoid arthritis	PMID: 17554300
Schizophrenia	PMID: 8546160
Wegener granulomatosis	PMID: 20049410

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
16084898	Endometrio sis	IL-2R beta-627*C homozygote, IL-12R beta 1 codon 37, IL-18 105				IL-2R beta IL-18	Show abstract