Endometriosis Knowledgebase

Search Result

Gene id

3567

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL5 Gene UCSC Ensembl

Aliases

EDF, IL-5, TRF

Gene name

interleukin 5

Alternate names

interleukin-5, B-cell differentiation factor I, T-cell replacing factor, colony-stimulating factor, eosinophil, eosinophil differentiation factor,

Gene location

5q31.1 (132556826: 132539193) Exons: 6 NC_000005.10

Gene summary(Entrez)

This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation, recruitment and survival. The increased production of this cytokine may be related to pathogenesis of eosinophil-dependent inflammatory diseases. This cytokine functions by binding to its receptor, which is a heterodimer, whose beta subunit is shared with the receptors for interleukine 3 (IL3) and colony stimulating factor 2 (CSF2/GM-CSF). This gene is located on chromosome 5 within a cytokine gene cluster which includes interleukin 4 (IL4), interleukin 13 (IL13), and CSF2 . This gene, IL4, and IL13 may be regulated coordinately by long-range regulatory elements spread over 120 kilobases on chromosome 5q31. [provided by RefSeq, Jul 2013]

OMIM

147850

Protein Summary

Protein general information

P05113

Name: Interleukin 5 (IL 5) (B cell differentiation factor I) (Eosinophil differentiation factor) (T cell replacing factor) (TRF)

Length: 134 Mass: 15,238

Sequence

MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLE
SQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES

Structural information

Interpro:	IPR009079 IPR000186
Pfam:	PF02025
PDB:	1HUL 3QT2 3VA2
PDBsum:	1HUL 3QT2 3VA2
DIP:	28
STRING:	ENSP00000231454;

Other Databases

GeneCards: IL5; Malacards: IL5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000165	MAPK cascade	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005137	interleukin-5 receptor bi nding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0030890	positive regulation of B cell proliferation	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045645	positive regulation of eo sinophil differentiation	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	ISS	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IBA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IEA	biological_process
GO:0071803	positive regulation of po dosome assembly	IDA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005137	interleukin-5 receptor bi nding	IEA	molecular_function
GO:0005137	interleukin-5 receptor bi nding	IEA	molecular_function
GO:0005137	interleukin-5 receptor bi nding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005622	intracellular	IEA	cellular_component
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0018108	peptidyl-tyrosine phospho rylation	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0030890	positive regulation of B cell proliferation	IEA	biological_process
GO:0030890	positive regulation of B cell proliferation	IBA	biological_process
GO:0043547	positive regulation of GT Pase activity	IEA	biological_process
GO:0045645	positive regulation of eo sinophil differentiation	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	ISS	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IEA	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IBA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IEA	biological_process
GO:0071803	positive regulation of po dosome assembly	IDA	biological_process
GO:0000165	MAPK cascade	TAS	biological_process
GO:0004713	protein tyrosine kinase a ctivity	TAS	molecular_function
GO:0005088	Ras guanyl-nucleotide exc hange factor activity	TAS	molecular_function
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005137	interleukin-5 receptor bi nding	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006954	inflammatory response	TAS	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IBA	biological_process
GO:0030890	positive regulation of B cell proliferation	IBA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	ISS	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IBA	biological_process
GO:0071803	positive regulation of po dosome assembly	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04657  IL-17 signaling pathway
hsa05321  Inflammatory bowel disease
hsa04640  Hematopoietic cell lineage
hsa04660  T cell receptor signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa04672  Intestinal immune network for IgA production
hsa04664  Fc epsilon RI signaling pathway
hsa05310  Asthma

Diseases

Associated diseases	References
Allergic rhinitis	PMID: 19222422
Asthma	PMID: 18849614
Atopy	PMID: 15007355
Celiac disease	PMID: 15713213
Dermatitis	PMID: 14581138
Eczema	PMID: 17620072
Endometriosis	PMID: 9436700
Hypertension	PMID: 19578876
Inflammatory bowel disease	PMID: 15842590
Male infertility	PMID: 19239426
Multiple sclerosis	PMID: 18563468
Nasal polyposis	PMID: 19860791
Endometriosis	INFBASE28433374
Schizophrenia	PMID: 19914334

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
9436700	Endometrio sis			IL-10 IL-5 IL-12	Show abstract
7904954	Endometrio sis	55 (32 patients had pelvic end ometriosis, 8 p ost-pelvic infl ammatory diseas e, 4 advanced c ancer, 3 adenom yosis, 3 benign ovarian tumor, and other dise ases)		IL-5 IL-6 IL-1	Show abstract
28433374	Endometrio sis	107 female infe rtility	Female infertility		Show abstract