Endometriosis Knowledgebase

Search Result

Gene id

3569

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL6 Gene UCSC Ensembl

Aliases

BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6

Gene name

interleukin 6

Alternate names

interleukin-6, B-cell differentiation factor, B-cell stimulatory factor 2, CTL differentiation factor, hybridoma growth factor, interferon beta-2, interleukin BSF-2,

Gene location

7p15.3 (22725888: 22732001) Exons: 6 NC_000007.14

Gene summary(Entrez)

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

OMIM

147620

SNPs

rs1800796

Strand:    Allele origin:   Allele change: C/G   Mutation type: snp

CM000669.2   g.22726627G>C
NC_000007.13   g.22766246G>C
NC_000007.14   g.22726627G>C
NG_011640.1   g.4481G>C
NM_000600.4   c.-636G>C
NM_001318095.1   c.-673G>C
NR_131935.1   n.132C>G

Protein Summary

Protein general information

P05231

Name: Interleukin 6 (IL 6) (B cell stimulatory factor 2) (BSF 2) (CTL differentiation factor) (CDF) (Hybridoma growth factor) (Interferon beta 2) (IFN beta 2)

Length: 212 Mass: 23,718

Sequence

MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKS
NMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL
IQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM

Structural information

Interpro:	IPR009079 IPR003574 IPR030474 IPR030473
Prosite:	PS00254
Pfam:	PF00489
PDB:	1ALU 1IL6 1N2Q 1P9M 2IL6 4CNI 4J4L 4NI7 4NI9 4O9H 4ZS7 5FUC
PDBsum:	1ALU 1IL6 1N2Q 1P9M 2IL6 4CNI 4J4L 4NI7 4NI9 4O9H 4ZS7 5FUC
DIP:	482
MINT:	190042
STRING:	ENSP00000258743;

Other Databases

GeneCards: IL6; Malacards: IL6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001781	neutrophil apoptotic proc ess	IDA	biological_process
GO:0001878	response to yeast	IEA	biological_process
GO:0002384	hepatic immune response	TAS	biological_process
GO:0002384	hepatic immune response	IDA	biological_process
GO:0002446	neutrophil mediated immun ity	TAS	biological_process
GO:0002548	monocyte chemotaxis	IC	biological_process
GO:0002675	positive regulation of ac ute inflammatory response	IDA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	TAS	biological_process
GO:0005125	cytokine activity	ISS	molecular_function
GO:0005125	cytokine activity	NAS	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0005138	interleukin-6 receptor bi nding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IEA	biological_process
GO:0006953	acute-phase response	TAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006959	humoral immune response	IC	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0009409	response to cold	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010574	regulation of vascular en dothelial growth factor p roduction	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010888	negative regulation of li pid storage	NAS	biological_process
GO:0010996	response to auditory stim ulus	IEA	biological_process
GO:0016049	cell growth	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0031000	response to caffeine	IEA	biological_process
GO:0031018	endocrine pancreas develo pment	ISS	biological_process
GO:0031175	neuron projection develop ment	IMP	biological_process
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0032494	response to peptidoglycan	NAS	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	NAS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0032966	negative regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IEA	biological_process
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042832	defense response to proto zoan	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IEA	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0045079	negative regulation of ch emokine biosynthetic proc ess	ISS	biological_process
GO:0045188	regulation of circadian s leep/wake cycle, non-REM sleep	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045454	cell redox homeostasis	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	NAS	biological_process
GO:0045630	positive regulation of T- helper 2 cell differentia tion	IEA	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	TAS	biological_process
GO:0045721	negative regulation of gl uconeogenesis	IEA	biological_process
GO:0045727	positive regulation of tr anslation	IDA	biological_process
GO:0045740	positive regulation of DN A replication	IEA	biological_process
GO:0045765	regulation of angiogenesi s	IC	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046677	response to antibiotic	IEA	biological_process
GO:0046716	muscle cell cellular home ostasis	IEA	biological_process
GO:0046849	bone remodeling	IEA	biological_process
GO:0046888	negative regulation of ho rmone secretion	IEA	biological_process
GO:0048635	negative regulation of mu scle organ development	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050710	negative regulation of cy tokine secretion	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050829	defense response to Gram- negative bacterium	TAS	biological_process
GO:0050830	defense response to Gram- positive bacterium	TAS	biological_process
GO:0050871	positive regulation of B cell activation	IDA	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051384	response to glucocorticoi d	IDA	biological_process
GO:0051592	response to calcium ion	IEA	biological_process
GO:0051602	response to electrical st imulus	IEA	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0051971	positive regulation of tr ansmission of nerve impul se	IEA	biological_process
GO:0060445	branching involved in sal ivary gland morphogenesis	IEA	biological_process
GO:0060664	epithelial cell prolifera tion involved in salivary gland morphogenesis	IEA	biological_process
GO:0070091	glucagon secretion	ISS	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IMP	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:0071864	positive regulation of ce ll proliferation in bone marrow	IEA	biological_process
GO:0072540	T-helper 17 cell lineage commitment	ISS	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:2000366	positive regulation of ST AT protein import into nu cleus	IC	biological_process
GO:2000676	positive regulation of ty pe B pancreatic cell apop totic process	TAS	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0001781	neutrophil apoptotic proc ess	IEA	biological_process
GO:0001781	neutrophil apoptotic proc ess	IDA	biological_process
GO:0001878	response to yeast	IEA	biological_process
GO:0002262	myeloid cell homeostasis	IEA	biological_process
GO:0002384	hepatic immune response	TAS	biological_process
GO:0002384	hepatic immune response	IDA	biological_process
GO:0002446	neutrophil mediated immun ity	TAS	biological_process
GO:0002548	monocyte chemotaxis	IC	biological_process
GO:0002675	positive regulation of ac ute inflammatory response	IDA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	TAS	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	ISS	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	NAS	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IEA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IEA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	TAS	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0005138	interleukin-6 receptor bi nding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0006469	negative regulation of pr otein kinase activity	IEA	biological_process
GO:0006953	acute-phase response	IEA	biological_process
GO:0006953	acute-phase response	TAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006959	humoral immune response	IC	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0008360	regulation of cell shape	IEA	biological_process
GO:0009408	response to heat	IEA	biological_process
GO:0009409	response to cold	IEA	biological_process
GO:0009611	response to wounding	IEA	biological_process
GO:0009612	response to mechanical st imulus	IEA	biological_process
GO:0009617	response to bacterium	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010574	regulation of vascular en dothelial growth factor p roduction	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IEA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010888	negative regulation of li pid storage	NAS	biological_process
GO:0010996	response to auditory stim ulus	IEA	biological_process
GO:0014070	response to organic cycli c compound	IEA	biological_process
GO:0016049	cell growth	IEA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0031000	response to caffeine	IEA	biological_process
GO:0031018	endocrine pancreas develo pment	IEA	biological_process
GO:0031018	endocrine pancreas develo pment	ISS	biological_process
GO:0031175	neuron projection develop ment	IMP	biological_process
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0032494	response to peptidoglycan	NAS	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	NAS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0032966	negative regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0033160	positive regulation of pr otein import into nucleus , translocation	IEA	biological_process
GO:0034097	response to cytokine	IEA	biological_process
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0042060	wound healing	IEA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042110	T cell activation	IEA	biological_process
GO:0042127	regulation of cell prolif eration	IEA	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IEA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0042593	glucose homeostasis	IEA	biological_process
GO:0042832	defense response to proto zoan	IEA	biological_process
GO:0042981	regulation of apoptotic p rocess	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043154	negative regulation of cy steine-type endopeptidase activity involved in apo ptotic process	IEA	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0045079	negative regulation of ch emokine biosynthetic proc ess	IEA	biological_process
GO:0045079	negative regulation of ch emokine biosynthetic proc ess	ISS	biological_process
GO:0045188	regulation of circadian s leep/wake cycle, non-REM sleep	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045454	cell redox homeostasis	IEA	biological_process
GO:0045599	negative regulation of fa t cell differentiation	NAS	biological_process
GO:0045630	positive regulation of T- helper 2 cell differentia tion	IEA	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045669	positive regulation of os teoblast differentiation	TAS	biological_process
GO:0045721	negative regulation of gl uconeogenesis	IEA	biological_process
GO:0045727	positive regulation of tr anslation	IDA	biological_process
GO:0045740	positive regulation of DN A replication	IEA	biological_process
GO:0045765	regulation of angiogenesi s	IC	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046677	response to antibiotic	IEA	biological_process
GO:0046716	muscle cell cellular home ostasis	IEA	biological_process
GO:0046849	bone remodeling	IEA	biological_process
GO:0046888	negative regulation of ho rmone secretion	IEA	biological_process
GO:0048635	negative regulation of mu scle organ development	IEA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050679	positive regulation of ep ithelial cell proliferati on	IEA	biological_process
GO:0050710	negative regulation of cy tokine secretion	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050829	defense response to Gram- negative bacterium	TAS	biological_process
GO:0050830	defense response to Gram- positive bacterium	TAS	biological_process
GO:0050871	positive regulation of B cell activation	IDA	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051384	response to glucocorticoi d	IDA	biological_process
GO:0051592	response to calcium ion	IEA	biological_process
GO:0051602	response to electrical st imulus	IEA	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0051897	positive regulation of pr otein kinase B signaling	IEA	biological_process
GO:0051971	positive regulation of tr ansmission of nerve impul se	IEA	biological_process
GO:0060445	branching involved in sal ivary gland morphogenesis	IEA	biological_process
GO:0060664	epithelial cell prolifera tion involved in salivary gland morphogenesis	IEA	biological_process
GO:0070091	glucagon secretion	IEA	biological_process
GO:0070091	glucagon secretion	ISS	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IEA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0070374	positive regulation of ER K1 and ERK2 cascade	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IMP	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071356	cellular response to tumo r necrosis factor	IEA	biological_process
GO:0071549	cellular response to dexa methasone stimulus	IEA	biological_process
GO:0071864	positive regulation of ce ll proliferation in bone marrow	IEA	biological_process
GO:0072540	T-helper 17 cell lineage commitment	IEA	biological_process
GO:0072540	T-helper 17 cell lineage commitment	ISS	biological_process
GO:1901215	negative regulation of ne uron death	IEA	biological_process
GO:2000366	positive regulation of ST AT protein import into nu cleus	IC	biological_process
GO:2000676	positive regulation of ty pe B pancreatic cell apop totic process	TAS	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0001781	neutrophil apoptotic proc ess	IDA	biological_process
GO:0002384	hepatic immune response	TAS	biological_process
GO:0002384	hepatic immune response	IDA	biological_process
GO:0002446	neutrophil mediated immun ity	TAS	biological_process
GO:0002548	monocyte chemotaxis	IC	biological_process
GO:0002675	positive regulation of ac ute inflammatory response	IDA	biological_process
GO:0002690	positive regulation of le ukocyte chemotaxis	TAS	biological_process
GO:0005125	cytokine activity	ISS	molecular_function
GO:0005125	cytokine activity	NAS	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005138	interleukin-6 receptor bi nding	TAS	molecular_function
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function
GO:0005138	interleukin-6 receptor bi nding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0005896	interleukin-6 receptor co mplex	IDA	cellular_component
GO:0006953	acute-phase response	TAS	biological_process
GO:0006954	inflammatory response	IDA	biological_process
GO:0006959	humoral immune response	IC	biological_process
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IMP	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008285	negative regulation of ce ll proliferation	TAS	biological_process
GO:0010574	regulation of vascular en dothelial growth factor p roduction	IDA	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010888	negative regulation of li pid storage	NAS	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0019221	cytokine-mediated signali ng pathway	IDA	biological_process
GO:0030168	platelet activation	TAS	biological_process
GO:0031018	endocrine pancreas develo pment	ISS	biological_process
GO:0031175	neuron projection develop ment	IMP	biological_process
GO:0032494	response to peptidoglycan	NAS	biological_process
GO:0032722	positive regulation of ch emokine production	IDA	biological_process
GO:0032722	positive regulation of ch emokine production	NAS	biological_process
GO:0032755	positive regulation of in terleukin-6 production	IDA	biological_process
GO:0032966	negative regulation of co llagen biosynthetic proce ss	IDA	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0042102	positive regulation of T cell proliferation	IDA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0042517	positive regulation of ty rosine phosphorylation of Stat3 protein	IDA	biological_process
GO:0043065	positive regulation of ap optotic process	IDA	biological_process
GO:0043066	negative regulation of ap optotic process	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0045079	negative regulation of ch emokine biosynthetic proc ess	ISS	biological_process
GO:0045599	negative regulation of fa t cell differentiation	NAS	biological_process
GO:0045669	positive regulation of os teoblast differentiation	TAS	biological_process
GO:0045727	positive regulation of tr anslation	IDA	biological_process
GO:0045765	regulation of angiogenesi s	IC	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	ISS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IDA	biological_process
GO:0048661	positive regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:0050829	defense response to Gram- negative bacterium	TAS	biological_process
GO:0050830	defense response to Gram- positive bacterium	TAS	biological_process
GO:0050871	positive regulation of B cell activation	IDA	biological_process
GO:0051024	positive regulation of im munoglobulin secretion	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051384	response to glucocorticoi d	IDA	biological_process
GO:0051607	defense response to virus	IDA	biological_process
GO:0070091	glucagon secretion	ISS	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070102	interleukin-6-mediated si gnaling pathway	IDA	biological_process
GO:0070301	cellular response to hydr ogen peroxide	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IMP	biological_process
GO:0072540	T-helper 17 cell lineage commitment	ISS	biological_process
GO:2000366	positive regulation of ST AT protein import into nu cleus	IC	biological_process
GO:2000676	positive regulation of ty pe B pancreatic cell apop totic process	TAS	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IDA	biological_process
GO:0005138	interleukin-6 receptor bi nding	IPI	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa04630  Jak-STAT signaling pathway
hsa04068  FoxO signaling pathway
hsa05202  Transcriptional misregulation in cancer
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04621  NOD-like receptor signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa05142  Chagas disease
hsa05162  Measles
hsa04657  IL-17 signaling pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04066  HIF-1 signaling pathway
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease
hsa04640  Hematopoietic cell lineage
hsa04620  Toll-like receptor signaling pathway
hsa05146  Amoebiasis
hsa05133  Pertussis
hsa04931  Insulin resistance
hsa05134  Legionellosis
hsa05132  Salmonella infection
hsa05144  Malaria
hsa05410  Hypertrophic cardiomyopathy
hsa05332  Graft-versus-host disease
hsa04672  Intestinal immune network for IgA production
hsa05143  African trypanosomiasis
hsa05020  Prion diseases
hsa04623  Cytosolic DNA-sensing pathway
hsa01523  Antifolate resistance

Diseases

Associated diseases	References
Acute pancreatitis	PMID: 19220961
Aggressive periodontitis	PMID: 19892918
Allergic rhinitis	PMID: 15120189
Alzheimer's disease	PMID: 10674995
Ankylosing spondylitis	PMID: 10852271
Asthenozoospermia	PMID: 24029665
Asthma	PMID: 15787640
Atherosclerosis	PMID: 11196657
Atopy	PMID: 15005726
Attention-deficit hyperactivity disorder (ADHD)	PMID: 18580852
Autoimmune thyroid disease (AITD)	PMID: 10843185
Azoospermia	PMID: 19811461
Behcet's disease	PMID: 19796538
Bullous pemphigoid	PMID: 16403098
Cardiovascular disease	PMID: 20061995
Castleman disease	KEGG: H01479
Celiac disease	PMID: 16540751
Cerebral palsy	PMID: 19238444
Cerebral palsy	PMID: 19938160
Chronic fatigue syndrome	PMID: 16762155
Chronic kidney failure	PMID: 17203290
Chronic lymphocytic leukemia	PMID: 10870116
Chronic obstructive pulmonary disease (COPD)	PMID: 17380888
Connective tissue diseases	PMID: 19527514
Crohn's disease	PMID: 18799360
Cystic fibrosis	PMID: 19009622
Dementia	PMID: 12086705
Depression	PMID: 18458677
Diabetes	OMIM: 147620
Endometriosis	PMID: 17062580
Endometriosis	PMID: 16758620
Endometriosis	PMID: 12174163
Endometriosis	PMID: 8653926
Erythema nodosum	PMID: 19225544
Gaucher disease	PMID: 12897342
Genital endometriosis	PMID: 16758620
Gential endometriosis	PMID: 16027877
Glomerulonephritis	PMID: 19420105
Gout	PMID: 19032817
Graves disease	PMID: 16313297
Graves ophthalmopathy	PMID: 19798110
Hyperandrogenism	PMID: 11889177
Hyperandrogenism	PMID: 11889177
Hypothalamic amenorrhea	PMID: 17094981
Impaired spermatogenesis	PMID: 19527232
Inflammation	PMID: 18922529
Inflammatory bowel disease	PMID: 11204808
Insulin resistance	PMID: 18991689
Irritable bowel syndrome	PMID: 19844779
Juvenile arthritis	PMID: 2577114
Kaposi's sarcoma	PMID: 11001912
Kawasaki disease	PMID: 15900570
Kidney disease	PMID: 11544437
Lacunar infarction	PMID: 11983287
Leukomalacia	PMID: 19147624
Lower implantation	PMID: 16705074
Male infertility	PMID: 12491092
Male infertility	PMID: 12623747
Metabolism disorders	PMID: 14557872
Migraine disorders	PMID: 19559392
Mood disorders	PMID: 19890236
Multiple sclerosis	PMID: 11072134
Myasthenia gravis	PMID: 2577114
Nephropathy	PMID: 11849463
Nephrotic syndrome	PMID: 19008611
Obesity	PMID: 15760495
Oligozoospermia	PMID: 17341438
Osteoarthritis	PMID: 12421093
Osteolysis	PMID: 18821666
Osteomyelitis	PMID: 18971305
Osteoporosis	PMID: 19299182
Ovarian endometriosis	PMID: 27337799
Ovarian endometriosis	PMID: 25797583
Ovarian hyperstimulation syndrome (OHSS)	PMID: 10783347
Pancreatitis	PMID: 18815552
Parkinson's disease	PMID: 15635591
Pelvic endometriosis	PMID: 15019814
Pelvic endometriosis	PMID: 12524084
Pelvic endometriosis	PMID: 26871558
Pelvic endometriosis	PMID: 26871558
Pemphigus	PMID: 19470040
Periodontal disease	PMID: 15341923
Periodontal disease	PMID: 17448042
Periodontitis	PMID: 15025214
Polycystic ovary syndrome (PCOS)	PMID: 23036804
Polycystic ovary syndrome (PCOS)	PMID: 15193488
Female infertility	INFBASE27337799
Ovarian endometriosis	INFBASE25797583
Endometriosis (ovarian)	INFBASE25797583
Female infertility	INFBASE25631342
Endometrioma	INFBASE20074813
Endometriosis,Infertility	INFBASE20007161
Ectopic endometriosis	INFBASE17953945
Unexplained infertility	INFBASE17688616
Genital endometriosis	INFBASE16758620
Female infertility	INFBASE16154044
External gential endometriosis	INFBASE16027877
Endometriosis associated infertility	INFBASE15831279
Pelvic endometriosis	INFBASE15019814
Female infertility	INFBASE12845737
Female infertility	INFBASE12700072
Pelvic endometriosis	INFBASE12524084
Endometriosis	INFBASE1281760
Preeclampsia	PMID: 25573795
Premature adrenarche	PMID: 22654787
Premature birth	PMID: 18951205
Preterm delivery	PMID: 19375805
Preterm delivery	PMID: 15516360
Preterm delivery	PMID: 16731080
Primary biliary cirrhosis	PMID: 15562761
Primary unexplained�infertility	PMID: 12161539
Prostatitis	PMID: 24329571
Psoriasis	PMID: 19784523
Recurrent miscarriage	PMID: 26952510
Repeated implantation failure (RIF)	PMID: 22201617
Respiratory distress syndrome	PMID: 18593632
Rhabdomyolysis	PMID: 18758806
Rheumatoid arthritis	PMID: 2577114, H01672
Sarcoidosis	PMID: 12737276
Schizophrenia	PMID: 14563376
Sepsis	PMID: 18375611
Sjogren's syndrome	PMID: 14872501
Sleep apnea	PMID: 19218687
Spermatogenetic defects	PMID: 11076089
Spermatogenetic defects	PMID: 16266398
Spinal diseases	PMID: 18469698
Stroke	PMID: 11983287
Sudden infant death syndrome (SIDS)	PMID: 16916659
Systemic lupus erythematosus	PMID: 2577114
Systemic scleroderma	PMID: 18576303
Testicular�dysfunction	PMID: 8822435
Tubal factor infertility	PMID: 9811536
Unexplained infertility	PMID: 24368037
Varicocele	PMID: 15533496

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12174163	Endometrio sis			50 (30 women wi th endometriosi s, 20 women wit hout endometrio sis)		IL-6 HGF	Show abstract
15831511	Endometrio sis			76 (46 women wi th endometriosi s, 30 women wit hout endometrio sis)		HGF	Show abstract
15201072	Endometrio sis			78 (54 women in reproductive a ge with endomet riosis confirme d by laparoscop y and histologi cal examination (including 28 cases of stages I/II and 26 of stages III/IV) , 24 endometr ium of healthy fertile women)		c-met HGF	Show abstract
12919890	Endometrio sis			126 (72 with en dometriosis, 54 without endome triosis)		HGF	Show abstract
10357985	Endometrio sis			76 (36 women wi th endometriosi s, 40 women wit hout endometrio sis)		HGF	Show abstract
9314916	Endometrio sis			11 (6 patients with endometrio sis, 5 without endometiosis)	Female infertility	HGF	Show abstract
15019814	Endometrio sis (Pelvi c)			45 (25 red lesi ons, 20 black l esions of pelvi c endometriosis )		HGF	Show abstract
12524084	Endometrio sis (Pelvi c)			25 (15 infertil e women with pe lvic endometrio sis, 10 v)		HGF c-Met	Show abstract
22563871	Endometrio sis					IL-6 TNF-alpha glycodelin A	Show abstract
12700072	Endometrio sis		Caucasi an, Afr ican Am erican, and Hi spanic	44 ( 10 fertile women undergoi ng bilateral tu bal ligation, 1 0 women with in fertility and w ithout clinical or laparoscopi c evidence of e ndometriosis, 1 2 with mild end ometriosis, 12 with severe end ometriosis )	Female infertility	IL10 IL6	Show abstract
1281760	Endometrio sis			55 (28 histolog ically confirme d endometriosis , 14 endometrio sis-free fertil e women, 13 inf ertile women)		IL6	Show abstract
17953945	Endometrio sis			12 (6 ectopic e ndometriosis, 6 eutopic endome triosis)		IL-6	Show abstract
17688616	Endometrio sis			57 infertile wo men undergoing laparoscopy for unexplained in fertility	Female infertility	MCP-1 IL-8 PDGF IL-6 RANTES IL-1 beta TNF-alpha and sFas	Show abstract
16154044	Endometrio sis			�78 women belon ging to four se lected subgroup s according to their endometri osis and/or�inf ertility	Female infertility	IL-1beta TNF-alpha IL-6 IL-8 ICAM-1	Show abstract
12845737	Endometrio sis			25 (14 infertil e patients with endometriosis (EMT group) and 11 infertile w omen with norma l pelvis (contr ol group))	Female infertility	TNF IL6	Show abstract
11821289	Endometrio sis			130 (56 endomet riosis, 8 idiop athic infertili ty, 27 underwen t tubal ligatio n or reanastomo sis (control gr oup) and 39 wer e excluded due to bloody PF)		TNF-alpha	Show abstract
10685516	Endometrio sis			20 (13 endometr iosis, 7 contro ls)	Female infertility		Show abstract
10632434	Endometrio sis			66 (34 with and 32 without end ometriosis, 10 oral contracept ive users under going tubal lig ation)	Female infertility	VEGF IL-6	Show abstract
25631342	Endometrio sis			89 (65 women in vestigated for secondary infer tility, 23 cont rols)	Female infertility	IL-1A IL-6 LIF LIFR and gp130	Show abstract
25376627	Endometrio sis			65 (31 patients with endometri osis, 34 patien ts without endo metriosis)	Female infertility	GPX3 IL6 IL8 TNF TXN TBPL2	Show abstract
23545836	Endometrio sis			114 (40 control s, 74 endometri osis patients )	Female infertility		Show abstract
12517591	Endometrio sis			164 (94 women w ith histologica lly confirmed e ndometriosis, 7 0 healthy contr ols)		IL-6	Show abstract
8299785	Endometrio sis			24 (Women under going tubal lig ations (n = 6), patients with postinflammator y pelvic adhesi ons unrelated t o endometriosis (n = 6), and w omen with minim al to mild endo metriosis (n = 6), or moderate to severe dise ase (n = 6))			Show abstract
7880401	Endometrio sis			62 women at the time of diagno stic or operati ve laparoscopic surgery for be nign gynecologi c disease		IFN-gamma IL-6	Show abstract
17582674	Endometrio sis					IL-6 MCP-1 INF-gamma VEGF TNF-alpha GM-CSF IL-2 IL-8 IL-15	Show abstract
16641167	Endometrio sis			73 (61 patients with endometri osis, 12 patien ts without endo metriosis)		TNFalpha IL-6	Show abstract
16006475	Endometrio sis			30 (18 infertil e women with en dometriosis, 12 women without endometriosis)		IL-6 TNFalpha	Show abstract
25035432	Endometrio sis			48 (33 women wi th endometriosi s, 15 women wit hout endometrio sis)		IL-6 granzyme B perforin	Show abstract
21983734	Endometrio sis	�IL-6 634C/G	Han Chi nese	931 (432 Ems pa tients, 499 con trol women)		IL-6	Show abstract
18684450	Endometrio sis			45 (35 patients with ovarian e ndometrioma, 10 patients with uterine myoma)		IL-10 IL-6 TNF-alpha	Show abstract
16938116	Endometrio sis	IL-6 -634C/G, ICAM-1 469K/E	Japanes e	438 (202 patien ts with endomet riosis, 236 con trol women)		IL-6 ICAM-1	Show abstract
9065123	Endometrio sis			27 (15 patients , 12 controls)		IL-6 IL-10 IL-2 IL-4 IL-5 GM-CSF	Show abstract
7832677	Endometrio sis			25 (14 patients with endometri osis, 11 patien ts with other d iseases (5 with myoma uteri, 5 with benign ov arian cysts and 1 with a doubl e uterus) as co ntrols)	Female infertility	IL-6 IL-1 GM-CSF	Show abstract
7904954	Endometrio sis			55 (32 patients had pelvic end ometriosis, 8 p ost-pelvic infl ammatory diseas e, 4 advanced c ancer, 3 adenom yosis, 3 benign ovarian tumor, and other dise ases)		IL-5 IL-6 IL-1	Show abstract
21546388	Endometrio sis					IL-6	Show abstract
15225199	Endometrio sis					IL-6	Show abstract
23553197	Endometrio sis			78 (10 minimal to mild endomet riosis, 26 mode rate to severe endometriosis, 42 controls)			Show abstract
22632541	Endometrio sis			133 PF of patie nts with endome triosis		IL-6 IL-18 eotaxin IL-12(p70) ICAM-1 GRO-? and MCP-1	Show abstract
20007161	Endometrio sis			294 (93 women w ith a normal pe lvis, 201 women with endometri osis)	Female infertility	IL-6 IL-8 CA-125	Show abstract
8550748	Endometrio sis			21 (14 patients with histologi cally documente d pelvic endome triosis, 7 norm al endometrial tissues)		IL-6 IL-11 P450arom	Show abstract
16553183	Endometrio sis			326 (47 women w ith endometrios is, 279 women w ithout endometr iosis)		IL-6 TNF-alpha ENA-78	Show abstract
9077612	Endometrio sis			39 women of rep roductive age u nderwent either laparoscopy fo r infertility w orkup or laparo scopic surgery for ovarian cho colate cysts		IL-6	Show abstract
8653926	Endometrio sis			64 (29 patients with endometri osis, 31 patien ts with benign ovarian masses, 4 patients wit h chronic infla mmation or adhe sions)		IL-6 sIL-6R	Show abstract
7714120	Endometrio sis			40 women		IL-6	Show abstract
8772585	Endometrio sis					IL-6	Show abstract
11776170	Endometrio sis			53 (31 cases wi th Endometriosi s, 22 cases wit hout endometrio sis )		IL-6 IL-8	Show abstract
15672963	Endometrio sis			63 women with v arious stages o f endometriosis		IL-6 b-FGF IL-8	Show abstract
15831279	Endometrio sis				Female infertility		Show abstract
20074813	Endometrio sis					IL-6 IL-8 IL-13 IL-17 and CA-125	Show abstract
11834864	Endometrio sis				Female infertility	IL-6 TNF-alpha	Show abstract
16027877	Endometrio sis (Genit al)				Female infertility	IL-1beta IL-2 IL-6 TGFbeta VEGF	Show abstract
16758620	Endometrio sis (Genit al)					IL-1beta IL-6 IGF-1	Show abstract
17062580	Endometrio sis			119 (38 control s, 47 endometri osis sufferers, 11 minimal-mil d endometriosis , 36 moderate-s evere endometri osis, 13 uterin e myomas, 21 be nign ovarian pa thologies)		IL-6 Ca-125	Show abstract
27337799	Endometrio sis (ovari an)			122 (64 patient s with ovarian endometriosis, 58 infertility cases caused by male side were used as contro l group)	Female infertility	IL-6 TNFA	Show abstract
25797583	Endometrio sis (ovari an)			98 (58 women wi th ovarian endo metriosis (case s), 40 healthy women undergoin g sterilization or patients wi th benign ovari an cysts (contr ols))	Female infertility	IL6 IL8 PAEP LEP	Show abstract
28300844	Endometrio sis					IL10 IL27 IL6 and TGFB1	Show abstract
28074436	Endometrio sis			34 (17 patients with confirme d endometriosis , 17 age-matche d NC-IVF women without diagnos ed endometriosi s as controls)	Female infertility	IL1B	Show abstract