Endometriosis Knowledgebase

Search Result

Gene id

3577

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCR1 Gene UCSC Ensembl

Aliases

C-C, C-C-CKR-1, CD128, CD181, CDw128a, CKR-1, CMKAR1, IL8R1, IL8RA, IL8RBA

Gene name

C-X-C motif chemokine receptor 1

Alternate names

C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, IL-8 receptor type 1, IL-8R A, chemokine (C-X-C motif) receptor 1, high affinity interleukin-8 receptor A, interleukin 8 receptor, alpha, interleukin-8 receptor type 1, interleukin-8 receptor type A,

Gene location

2q35 (218166992: 218162844) Exons: 2 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. Knockout studies in mice suggested that this protein inhibits embryonic oligodendrocyte precursor migration in developing spinal cord. This gene, IL8RB, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. [provided by RefSeq, Jul 2008]

OMIM

146929

Protein Summary

Protein general information

P25024

Name: C X C chemokine receptor type 1 (CXC R1) (CXCR 1) (CDw128a) (High affinity interleukin 8 receptor A) (IL 8R A) (IL 8 receptor type 1) (CD antigen CD181)

Length: 350 Mass: 39,791

Sequence

MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLVMLVILYSRVGRSVTD
VYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKR
HLVKFVCLGCWGLSMNLSLPFFLFRQAYHPNNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFT
LRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL

Structural information

Interpro:	IPR001355 IPR000174 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
PDB:	1ILP 1ILQ 2LNL
PDBsum:	1ILP 1ILQ 2LNL
DIP:	3779
MINT:	1516942
STRING:	ENSP00000295683;

Other Databases

GeneCards: CXCR1; Malacards: CXCR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0004918	interleukin-8 receptor ac tivity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0019959	interleukin-8 binding	IPI	molecular_function
GO:0031623	receptor internalization	IDA	biological_process
GO:0038112	interleukin-8-mediated si gnaling pathway	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004918	interleukin-8 receptor ac tivity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	TAS	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0019959	interleukin-8 binding	IEA	molecular_function
GO:0019959	interleukin-8 binding	IPI	molecular_function
GO:0031623	receptor internalization	IDA	biological_process
GO:0038112	interleukin-8-mediated si gnaling pathway	IEA	biological_process
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0004918	interleukin-8 receptor ac tivity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	TAS	molecular_function
GO:0004950	chemokine receptor activi ty	TAS	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006935	chemotaxis	TAS	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	TAS	biological_process
GO:0016020	membrane	TAS	cellular_component
GO:0019959	interleukin-8 binding	IPI	molecular_function
GO:0031623	receptor internalization	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04072  Phospholipase D signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection

Diseases

Associated diseases	References
Adenomyosis	PMID: 16500343
Endometriosis	PMID: 22563025
Endometriosis	INFBASE15618253

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
22563025	Endometrio sis					CXCL8 CXCR1 PTEN AKT	Show abstract
15618253	Endometrio sis			79 (27 ectopic endometrium tis sues from women with endometri osis, 25 eutopi c endometrium from women with endometriosis, 27 endometrium from women wit hout endometrio sis)		IL-8 CXCR1 CXCR2	Show abstract