Endometriosis Knowledgebase

Search Result

Gene id

3578

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL9 Gene UCSC Ensembl

Aliases

HP40, IL-9, P40

Gene name

interleukin 9

Alternate names

interleukin-9, T-cell growth factor p40, cytokine P40, homolog of mouse T cell and mast cell growth factor 40, p40 T-cell and mast cell growth factor, p40 cytokine,

Gene location

5q31.1 (135895826: 135892245) Exons: 5 NC_000005.10

Gene summary(Entrez)

The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq, Jul 2008]

OMIM

146931

Protein Summary

Protein general information

P15248

Name: Interleukin-9 (IL-9) (Cytokine P40) (T-cell growth factor P40)

Length: 144 Mass: 15,909

Sequence

MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQ
MTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Structural information

Interpro:	IPR018049 IPR000226 IPR020447
Prosite:	PS00255
Pfam:	PF01415
DIP:	3155
STRING:	ENSP00000274520;

Other Databases

GeneCards: IL9; Malacards: IL9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005140	interleukin-9 receptor bi nding	IEA	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0045407	positive regulation of in terleukin-5 biosynthetic process	ISS	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005126	cytokine receptor binding	IEA	molecular_function
GO:0005140	interleukin-9 receptor bi nding	IEA	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006954	inflammatory response	TAS	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0030307	positive regulation of ce ll growth	IEA	biological_process
GO:0045407	positive regulation of in terleukin-5 biosynthetic process	IEA	biological_process
GO:0045407	positive regulation of in terleukin-5 biosynthetic process	ISS	biological_process
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0006954	inflammatory response	TAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	TAS	biological_process
GO:0045407	positive regulation of in terleukin-5 biosynthetic process	ISS	biological_process

Diseases

Associated diseases	References
Asthma	PMID: 19536153
Brain Ischemia	PMID: 19028820
Brain ischemia	PMID: 19729601
Celiac disease	PMID: 19845895
Chorioamnionitis	PMID: 20452482
Coronary artery disease	PMID: 18612209
Endometriosis	PMID: 28433374
Hodgkin Disease	PMID: 19573080
Lymphoma	PMID: 18633131
Migraine disorders	PMID: 19559392
Multiple myeloma	PMID: 20568250
Multiple sclerosis	PMID: 18563468
Endometriosis	INFBASE28433374
Schizophrenia	PMID: 18298822
Endometriosis	PMID: 28433374

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
28433374	Endometrio sis			107 female infe rtility	Female infertility		Show abstract