Endometriosis Knowledgebase

Search Result

Gene id

3579

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

CXCR2 Gene UCSC Ensembl

Aliases

CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB

Gene name

C-X-C motif chemokine receptor 2

Alternate names

C-X-C chemokine receptor type 2, CXC-R2, CXCR-2, CXCR2 gene for IL8 receptor type B, GRO/MGSA receptor, IL-8 receptor type 2, IL-8R B, chemokine (CXC) receptor 2, high affinity interleukin-8 receptor B, interleukin 8 receptor type 2, interleukin 8 receptor, beta, in,

Gene location

2q35 (218125289: 218137252) Exons: 6 NC_000002.12

Gene summary(Entrez)

The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2009]

OMIM

146928

Protein Summary

Protein general information

P25025

Name: C X C chemokine receptor type 2 (CXC R2) (CXCR 2) (CDw128b) (GRO/MGSA receptor) (High affinity interleukin 8 receptor B) (IL 8R B) (IL 8 receptor type 2) (CD antigen CD182)

Length: 360 Mass: 40,759

Sequence

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFLLSLLGNSLVMLVILY
SRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVNFYSGILLLACISVDRYLAIVH
ATRTLTQKRYLVKFICLSIWGLSLLLALPVLLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLL
IMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL

Structural information

Interpro:	IPR000057 IPR000174 IPR000276 IPR017452
Prosite:	PS00237 PS50262
Pfam:	PF00001
PDB:	4Q3H 5TYT
PDBsum:	4Q3H 5TYT
DIP:	3782
MINT:	271138
STRING:	ENSP00000319635;

Other Databases

GeneCards: CXCR2; Malacards: CXCR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0004871	signal transducer activit y	IDA	molecular_function
GO:0004871	signal transducer activit y	IDA	molecular_function
GO:0004871	signal transducer activit y	IDA	molecular_function
GO:0004918	interleukin-8 receptor ac tivity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IDA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006968	cellular defense response	IDA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016494	C-X-C chemokine receptor activity	IDA	molecular_function
GO:0019959	interleukin-8 binding	IPI	molecular_function
GO:0030593	neutrophil chemotaxis	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0038112	interleukin-8-mediated si gnaling pathway	IEA	biological_process
GO:0042119	neutrophil activation	IDA	biological_process
GO:0042629	mast cell granule	IDA	cellular_component
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0004871	signal transducer activit y	IEA	molecular_function
GO:0004871	signal transducer activit y	IDA	molecular_function
GO:0004871	signal transducer activit y	IDA	molecular_function
GO:0004871	signal transducer activit y	IDA	molecular_function
GO:0004918	interleukin-8 receptor ac tivity	IDA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0004930	G-protein coupled recepto r activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	IEA	biological_process
GO:0006935	chemotaxis	IDA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006968	cellular defense response	IDA	biological_process
GO:0007165	signal transduction	IEA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007186	G-protein coupled recepto r signaling pathway	IEA	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016494	C-X-C chemokine receptor activity	IEA	molecular_function
GO:0016494	C-X-C chemokine receptor activity	IDA	molecular_function
GO:0019959	interleukin-8 binding	IEA	molecular_function
GO:0019959	interleukin-8 binding	IPI	molecular_function
GO:0030593	neutrophil chemotaxis	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0038112	interleukin-8-mediated si gnaling pathway	IEA	biological_process
GO:0042119	neutrophil activation	IDA	biological_process
GO:0042629	mast cell granule	IDA	cellular_component
GO:0070098	chemokine-mediated signal ing pathway	IEA	biological_process
GO:0002407	dendritic cell chemotaxis	TAS	biological_process
GO:0004871	signal transducer activit y	IDA	molecular_function
GO:0004871	signal transducer activit y	IDA	molecular_function
GO:0004871	signal transducer activit y	IDA	molecular_function
GO:0004918	interleukin-8 receptor ac tivity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006935	chemotaxis	IDA	biological_process
GO:0006954	inflammatory response	TAS	biological_process
GO:0006968	cellular defense response	IDA	biological_process
GO:0007165	signal transduction	IDA	biological_process
GO:0007165	signal transduction	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	IDA	biological_process
GO:0007200	phospholipase C-activatin g G-protein coupled recep tor signaling pathway	IDA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016494	C-X-C chemokine receptor activity	IDA	molecular_function
GO:0019959	interleukin-8 binding	IPI	molecular_function
GO:0030593	neutrophil chemotaxis	IDA	biological_process
GO:0031623	receptor internalization	IDA	biological_process
GO:0042119	neutrophil activation	IDA	biological_process
GO:0042629	mast cell granule	IDA	cellular_component

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04144  Endocytosis
hsa04072  Phospholipase D signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection

Diseases

Associated diseases	References
Adenomyosis	PMID: 16500343
Endometriosis	PMID: 15618253
Endometriosis	INFBASE15618253
Ulcerative colitis	PMID: 21297633

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
15618253	Endometrio sis			79 (27 ectopic endometrium tis sues from women with endometri osis, 25 eutopi c endometrium from women with endometriosis, 27 endometrium from women wit hout endometrio sis)		IL-8 CXCR1 CXCR2	Show abstract