Endometriosis Knowledgebase

Search Result

Gene id

3586

Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL10 Gene UCSC Ensembl

Aliases

CSIF, GVHDS, IL-10, IL10A, TGIF

Gene name

interleukin 10

Alternate names

interleukin-10, T-cell growth inhibitory factor, cytokine synthesis inhibitory factor,

Gene location

1q32.1 (206772493: 206767602) Exons: 5 NC_000001.11

Gene summary(Entrez)

The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class II Ags, and costimulatory molecules on macrophages. It also enhances B cell survival, proliferation, and antibody production. This cytokine can block NF-kappa B activity, and is involved in the regulation of the JAK-STAT signaling pathway. Knockout studies in mice suggested the function of this cytokine as an essential immunoregulator in the intestinal tract. Mutations in this gene are associated with an increased susceptibility to HIV-1 infection and rheumatoid arthritis.[provided by RefSeq, May 2011]

OMIM

124092

SNPs

rs1800872

Strand:    Allele origin:   Allele change: A/C   Mutation type: snp

CM000663.2   g.206773062T>G
NC_000001.10   g.206946407T>G
NC_000001.11   g.206773062T>G
NG_012088.1   g.4433A>C
NM_000572.2   c.-627A>C
rs3024496

Strand:    Allele origin:   Allele change: C/T   Mutation type: snp

CM000663.2   g.206768519A>G
NC_000001.10   g.206941864A>G
NC_000001.11   g.206768519A>G
NG_012088.1   g.8976T>C
NM_000572.2   c.*117T>C

Protein Summary

Protein general information

P22301

Name: Interleukin 10 (IL 10) (Cytokine synthesis inhibitory factor) (CSIF)

Length: 178 Mass: 20,517

Tissue specificity: Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types.

Sequence

MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFK
GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQ
EKGIYKAMSEFDIFINYIEAYMTMKIRN

Structural information

Interpro:	IPR009079 IPR000098 IPR020443 IPR020423
Prosite:	PS00520
Pfam:	PF00726
PDB:	1ILK 1INR 1J7V 1LK3 1Y6K 2H24 2ILK
PDBsum:	1ILK 1INR 1J7V 1LK3 1Y6K 2H24 2ILK
DIP:	3511
MINT:	206740
STRING:	ENSP00000412237;

Other Databases

GeneCards: IL10; Malacards: IL10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002237	response to molecule of b acterial origin	IDA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0002875	negative regulation of ch ronic inflammatory respon se to antigenic stimulus	IEA	biological_process
GO:0002904	positive regulation of B cell apoptotic process	IDA	biological_process
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005125	cytokine activity	NAS	molecular_function
GO:0005141	interleukin-10 receptor b inding	IBA	molecular_function
GO:0005141	interleukin-10 receptor b inding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006954	inflammatory response	IDA	biological_process
GO:0007253	cytoplasmic sequestering of NF-kappaB	NAS	biological_process
GO:0007267	cell-cell signaling	IC	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008083	growth factor activity	NAS	molecular_function
GO:0010468	regulation of gene expres sion	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014854	response to inactivity	IEA	biological_process
GO:0030097	hemopoiesis	TAS	biological_process
GO:0030183	B cell differentiation	NAS	biological_process
GO:0030595	leukocyte chemotaxis	TAS	biological_process
GO:0030886	negative regulation of my eloid dendritic cell acti vation	IEA	biological_process
GO:0030889	negative regulation of B cell proliferation	IDA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IEA	biological_process
GO:0032692	negative regulation of in terleukin-1 production	TAS	biological_process
GO:0032695	negative regulation of in terleukin-12 production	TAS	biological_process
GO:0032701	negative regulation of in terleukin-18 production	TAS	biological_process
GO:0032715	negative regulation of in terleukin-6 production	IDA	biological_process
GO:0032715	negative regulation of in terleukin-6 production	TAS	biological_process
GO:0032717	negative regulation of in terleukin-8 production	TAS	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	TAS	biological_process
GO:0032800	receptor biosynthetic pro cess	IDA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0034465	response to carbon monoxi de	IEA	biological_process
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0042092	type 2 immune response	TAS	biological_process
GO:0042100	B cell proliferation	NAS	biological_process
GO:0042130	negative regulation of T cell proliferation	NAS	biological_process
GO:0042130	negative regulation of T cell proliferation	NAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042536	negative regulation of tu mor necrosis factor biosy nthetic process	IEA	biological_process
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0042832	defense response to proto zoan	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	NAS	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0045019	negative regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045191	regulation of isotype swi tching	NAS	biological_process
GO:0045347	negative regulation of MH C class II biosynthetic p rocess	TAS	biological_process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IEA	biological_process
GO:0045355	negative regulation of in terferon-alpha biosynthet ic process	NAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IBA	biological_process
GO:0050715	positive regulation of cy tokine secretion	IDA	biological_process
GO:0051045	negative regulation of me mbrane protein ectodomain proteolysis	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051384	response to glucocorticoi d	IDA	biological_process
GO:0051930	regulation of sensory per ception of pain	IEA	biological_process
GO:0060302	negative regulation of cy tokine activity	IMP	biological_process
GO:0060670	branching involved in lab yrinthine layer morphogen esis	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	NAS	biological_process
GO:0071392	cellular response to estr adiol stimulus	IEA	biological_process
GO:0071650	negative regulation of ch emokine (C-C motif) ligan d 5 production	TAS	biological_process
GO:1903659	regulation of complement- dependent cytotoxicity	IMP	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IMP	biological_process
GO:0001818	negative regulation of cy tokine production	IEA	biological_process
GO:0002237	response to molecule of b acterial origin	IDA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0002875	negative regulation of ch ronic inflammatory respon se to antigenic stimulus	IEA	biological_process
GO:0002904	positive regulation of B cell apoptotic process	IDA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	NAS	molecular_function
GO:0005141	interleukin-10 receptor b inding	IEA	molecular_function
GO:0005141	interleukin-10 receptor b inding	IBA	molecular_function
GO:0005141	interleukin-10 receptor b inding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006954	inflammatory response	IDA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	IEA	biological_process
GO:0007253	cytoplasmic sequestering of NF-kappaB	NAS	biological_process
GO:0007267	cell-cell signaling	IC	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008083	growth factor activity	NAS	molecular_function
GO:0010033	response to organic subst ance	IEA	biological_process
GO:0010468	regulation of gene expres sion	IDA	biological_process
GO:0014823	response to activity	IEA	biological_process
GO:0014854	response to inactivity	IEA	biological_process
GO:0030097	hemopoiesis	TAS	biological_process
GO:0030183	B cell differentiation	NAS	biological_process
GO:0030595	leukocyte chemotaxis	TAS	biological_process
GO:0030886	negative regulation of my eloid dendritic cell acti vation	IEA	biological_process
GO:0030889	negative regulation of B cell proliferation	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IEA	biological_process
GO:0032689	negative regulation of in terferon-gamma production	IEA	biological_process
GO:0032692	negative regulation of in terleukin-1 production	TAS	biological_process
GO:0032695	negative regulation of in terleukin-12 production	IEA	biological_process
GO:0032695	negative regulation of in terleukin-12 production	TAS	biological_process
GO:0032701	negative regulation of in terleukin-18 production	TAS	biological_process
GO:0032715	negative regulation of in terleukin-6 production	IDA	biological_process
GO:0032715	negative regulation of in terleukin-6 production	TAS	biological_process
GO:0032717	negative regulation of in terleukin-8 production	TAS	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	IEA	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	TAS	biological_process
GO:0032800	receptor biosynthetic pro cess	IDA	biological_process
GO:0032868	response to insulin	IEA	biological_process
GO:0034465	response to carbon monoxi de	IEA	biological_process
GO:0035729	cellular response to hepa tocyte growth factor stim ulus	IEA	biological_process
GO:0042092	type 2 immune response	TAS	biological_process
GO:0042100	B cell proliferation	NAS	biological_process
GO:0042130	negative regulation of T cell proliferation	NAS	biological_process
GO:0042130	negative regulation of T cell proliferation	NAS	biological_process
GO:0042493	response to drug	IEA	biological_process
GO:0042536	negative regulation of tu mor necrosis factor biosy nthetic process	IEA	biological_process
GO:0042742	defense response to bacte rium	IEA	biological_process
GO:0042832	defense response to proto zoan	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	IEA	biological_process
GO:0043066	negative regulation of ap optotic process	NAS	biological_process
GO:0044130	negative regulation of gr owth of symbiont in host	IEA	biological_process
GO:0045019	negative regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045191	regulation of isotype swi tching	NAS	biological_process
GO:0045347	negative regulation of MH C class II biosynthetic p rocess	TAS	biological_process
GO:0045348	positive regulation of MH C class II biosynthetic p rocess	IEA	biological_process
GO:0045355	negative regulation of in terferon-alpha biosynthet ic process	NAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IBA	biological_process
GO:0050715	positive regulation of cy tokine secretion	IDA	biological_process
GO:0050728	negative regulation of in flammatory response	IEA	biological_process
GO:0051045	negative regulation of me mbrane protein ectodomain proteolysis	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051384	response to glucocorticoi d	IEA	biological_process
GO:0051384	response to glucocorticoi d	IDA	biological_process
GO:0051930	regulation of sensory per ception of pain	IEA	biological_process
GO:0060302	negative regulation of cy tokine activity	IMP	biological_process
GO:0060670	branching involved in lab yrinthine layer morphogen esis	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0071222	cellular response to lipo polysaccharide	NAS	biological_process
GO:0071392	cellular response to estr adiol stimulus	IEA	biological_process
GO:0071650	negative regulation of ch emokine (C-C motif) ligan d 5 production	TAS	biological_process
GO:1903659	regulation of complement- dependent cytotoxicity	IMP	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IMP	biological_process
GO:0002237	response to molecule of b acterial origin	IDA	biological_process
GO:0002740	negative regulation of cy tokine secretion involved in immune response	IDA	biological_process
GO:0002904	positive regulation of B cell apoptotic process	IDA	biological_process
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005125	cytokine activity	NAS	molecular_function
GO:0005141	interleukin-10 receptor b inding	IBA	molecular_function
GO:0005141	interleukin-10 receptor b inding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005615	extracellular space	IDA	cellular_component
GO:0006954	inflammatory response	IDA	biological_process
GO:0007253	cytoplasmic sequestering of NF-kappaB	NAS	biological_process
GO:0007267	cell-cell signaling	IC	biological_process
GO:0008083	growth factor activity	NAS	molecular_function
GO:0010468	regulation of gene expres sion	IDA	biological_process
GO:0030097	hemopoiesis	TAS	biological_process
GO:0030183	B cell differentiation	NAS	biological_process
GO:0030595	leukocyte chemotaxis	TAS	biological_process
GO:0030889	negative regulation of B cell proliferation	IDA	biological_process
GO:0032692	negative regulation of in terleukin-1 production	TAS	biological_process
GO:0032695	negative regulation of in terleukin-12 production	TAS	biological_process
GO:0032701	negative regulation of in terleukin-18 production	TAS	biological_process
GO:0032715	negative regulation of in terleukin-6 production	IDA	biological_process
GO:0032715	negative regulation of in terleukin-6 production	TAS	biological_process
GO:0032717	negative regulation of in terleukin-8 production	TAS	biological_process
GO:0032720	negative regulation of tu mor necrosis factor produ ction	TAS	biological_process
GO:0032800	receptor biosynthetic pro cess	IDA	biological_process
GO:0042092	type 2 immune response	TAS	biological_process
GO:0042100	B cell proliferation	NAS	biological_process
GO:0042130	negative regulation of T cell proliferation	NAS	biological_process
GO:0042130	negative regulation of T cell proliferation	NAS	biological_process
GO:0043066	negative regulation of ap optotic process	NAS	biological_process
GO:0045191	regulation of isotype swi tching	NAS	biological_process
GO:0045347	negative regulation of MH C class II biosynthetic p rocess	TAS	biological_process
GO:0045355	negative regulation of in terferon-alpha biosynthet ic process	NAS	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0046427	positive regulation of JA K-STAT cascade	IBA	biological_process
GO:0050715	positive regulation of cy tokine secretion	IDA	biological_process
GO:0051045	negative regulation of me mbrane protein ectodomain proteolysis	IDA	biological_process
GO:0051091	positive regulation of se quence-specific DNA bindi ng transcription factor a ctivity	IDA	biological_process
GO:0051384	response to glucocorticoi d	IDA	biological_process
GO:0060302	negative regulation of cy tokine activity	IMP	biological_process
GO:0071222	cellular response to lipo polysaccharide	NAS	biological_process
GO:0071650	negative regulation of ch emokine (C-C motif) ligan d 5 production	TAS	biological_process
GO:1903659	regulation of complement- dependent cytotoxicity	IMP	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IMP	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa05152  Tuberculosis
hsa05169  Epstein-Barr virus infection
hsa04630  Jak-STAT signaling pathway
hsa04068  FoxO signaling pathway
hsa05145  Toxoplasmosis
hsa05142  Chagas disease
hsa05321  Inflammatory bowel disease
hsa05146  Amoebiasis
hsa04660  T cell receptor signaling pathway
hsa05140  Leishmaniasis
hsa05133  Pertussis
hsa05144  Malaria
hsa05320  Autoimmune thyroid disease
hsa05322  Systemic lupus erythematosus
hsa05330  Allograft rejection
hsa04672  Intestinal immune network for IgA production
hsa05143  African trypanosomiasis
hsa05150  Staphylococcus aureus infection
hsa05310  Asthma

Diseases

Associated diseases	References
Adenomyosis	PMID: 18439592
Aggressive periodontitis	PMID: 19210338
Allergic rhinitis	PMID: 15120189
Allergies	PMID: 11354638
Alzheimer's disease	PMID: 14746878
Anaphylaxis	KEGG: H01359
Aphthous stomatitis	PMID: 14629328
Arthritis	PMID: 11315919
Asthma	PMID: 19264973
Atopy	PMID: 15007355
Atopy	PMID: 16759385
Azoospermia	PMID: 19811461
Behcet's disease	KEGG: H01476
Biliary atresia	PMID: 12100571
Cancer	PMID: 15709194
Celiac disease	PMID: 15979955
Cerebral palsy	PMID: 19238444
Chorioretinitis	PMID: 18436829
Chronic fatigue syndrome	PMID: 16762155
Chronic kidney failure	PMID: 19578796
Chronic obstructive pulmonary disease (COPD)	PMID: 14669219
Chronic Periodontitis	PMID: 18725394
Churg-Strauss Syndrome	PMID: 18512809
Clonorchiasis	PMID: 19488421
Connective tissue diseases	PMID: 19527514
Crohn's disease	PMID: 16165702
Cystic fibrosis	PMID: 19009622
Depression	PMID: 19087313
Dermatitis	PMID: 16681592
Diabetes	PMID: 19700864
Endometriosis	PMID: 11327093
Eosinophilic granulomatosis with polyangiitis	KEGG: H01468
Female infertility	PMID: 17051272
Gallbladder diseases	PMID: 19065724
Gastric disease	PMID: 19295440
Glomerulonephritis	PMID: 19034880
Hemophilia A	PMID: 16380445
Hyperandrogenism	PMID: 10372707
Hypersensitivity	PMID: 18440625
Implantation failure	PMID: 12615834
Inflammatory bowel disease	KEGG: H01227
Irritable bowel syndrome	PMID: 16780675
Juvenile arthritis	PMID: 12195624
Kawasaki disease	PMID: 14744383
Kidney disease	PMID: 15104679
Lung disease	PMID: 18493769
Lymphocytosis	PMID: 18361934
Male infertility	PMID: 15595690
Metabolic syndrome	PMID: 19056482
Migraine disorders	PMID: 19559392
Mucocutaneous lymph node syndrome	PMID: 19543506
Multiple sclerosis	PMID: 14616291
Myasthenia gravis	PMID: 17509455
Myasthenia gravis	PMID: 19299022
Myocardial infarction	PMID: 16184405
Nephropathy	PMID: 16493441
Obesity	PMID: 19798061
Oligoteratoasthenoazoospermia	PMID: 10526637
Omenn syndrome	PMID: 17572155
Osteoarthritis	PMID: 12421093
Osteoporosis	PMID: 15927351
Ovarian endometriosis	PMID: 23025883
Ovarian hyperstimulation syndrome(OHSS)	PMID: 26823856
Pancreatitis	PMID: 15066699
Panencephalitis	PMID: 12020266
Parkinson's disease	PMID: 18362084
Pelvic endometriosis	PMID: 26871558
Pelvic endometriosis	PMID: 26871558
Pelvic endometriosis	PMID: 26871558
Pemphigus	PMID: 19470040
Periodontal disease	PMID: 17511783
Periodontitis	PMID: 12631183
Polycystic ovary syndrome (PCOS)	PMID: 18218037
Endometrioma	INFBASE23025883
Preeclampsia	PMID: 19407822
Endometriosis (ovarian)	INFBASE23025883
Female infertility	INFBASE12700072
Endometriosis	INFBASE8612850
Premature birth	PMID: 18674658
Prostatic hyperplasia	PMID: 16461080
Prostatitis	PMID: 24329571
Psoriasis	PMID: 11298547
Recurrent implantation failure (RIF)	PMID: 12615834
Recurrent pregnancy loss (RPL)/ Abortion/ Miscarriage/ Recurrent pregnancy failure/Pregnancy loss/ Recurrent miscarriage/ Spontaneous abortion	PMID: 19208551
Respiratory distress syndrome	PMID: 17314689
Rheumatoid arthritis	OMIM: 124092
Sarcoidosis	PMID: 11436536
Schizophrenia	PMID: 14563376
Severe Acute Respiratory Syndrome	PMID: 19258635
Sjogren's syndrome	PMID: 14872501
Spontaneous preterm birth	PMID: 15042002
Systemic lupus erythematosus	PMID: 12126589
Tubal factor infertility	PMID: 12151439
Ulcerative colitis	PMID: 18569989
Ulcerative colitis	KEGG: H01466
Unexplained infertility	PMID: 24368037
Uveitis	PMID: 16024856
Wegener granulomatosis	PMID: 11838849

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
12700072	Endometrio sis		Caucasi an, Afr ican Am erican, and Hi spanic	44 ( 10 fertile women undergoi ng bilateral tu bal ligation, 1 0 women with in fertility and w ithout clinical or laparoscopi c evidence of e ndometriosis, 1 2 with mild end ometriosis, 12 with severe end ometriosis )	Female infertility	IL10 IL6	Show abstract
16359969	Endometrio sis			35 (15 women wi th endometriosi s, 20 fertile c ontrols)		IL-4 IL-10	Show abstract
19299454	Endometrio sis			593 (196 cases with pathologic ally proved end ometriosis, 397 disease-free w omen as control subjects)		COX-2 MIF IL-6 IL-10 IL-1 beta	Show abstract
17234676	Endometrio sis			98 with and wit hout endometrio sis		IFN-gamma IL-10 IL-4 IL-2	Show abstract
23237776	Endometrio sis	IL-10 -592 A/C, IL-10 -1082 A/G, IL-10 -819 T/C	Asian				Show abstract
21055074	Endometrio sis	IL-10 (1082(G->A), 819(C->T) and 592(C->A))		374 (214 patien ts with endomet riosis, 160 hea lthy individual s)		IL-10	Show abstract
20618176	Endometrio sis	IL-10 (1082(G>A), 819(C>T) and 592(C>A))	Danish	458 (100 Danish patients with endometriosis, 358 healthy Dan ish blood donor s)		IL-10	Show abstract
19586841	Endometrio sis	IL-10-819 (T/C) and -592 (A/C)	Chinese	239 (119 women with different stage Ems, 120 controls)		IL-10	Show abstract
18930197	Endometrio sis	IL-10 (rs1800871)		593 (196 cases with pathologic ally proved end ometriosis, 397 disease-free w omen as control subjects)		IL-10 IL-6 IL-1 beta and cyclooxygenase-2	Show abstract
18687423	Endometrio sis	ERalpha (X allele of ERalpha-XbaI), IL-10 (-592 or -819 C allele )	Chinese	374 (214 affect ed women, 160 c ontrols)		Eralpha IL-10	Show abstract
18684450	Endometrio sis			45 (35 patients with ovarian e ndometrioma, 10 patients with uterine myoma)		IL-10 IL-6 TNF-alpha	Show abstract
17178764	Endometrio sis	IL-10 (-1082, -819 and -592 site)				IL-10	Show abstract
14562641	Endometrio sis	IL-10 (-627 gene promoter polymorphism)		263 (130 endome triosis, 133 no n endometriosis )		IL-10	Show abstract
11883743	Endometrio sis	IL-10 (Polymorphisms at position -1082 and -592)		356 (96 patient s with endometr iosis, 160 fert ile healthy wom en)		carbonic anhydrase II IL-10	Show abstract
9065123	Endometrio sis			27 (15 patients , 12 controls)		IL-6 IL-10 IL-2 IL-4 IL-5 GM-CSF	Show abstract
9436700	Endometrio sis					IL-10 IL-5 IL-12	Show abstract
23553197	Endometrio sis			78 (10 minimal to mild endomet riosis, 26 mode rate to severe endometriosis, 42 controls)			Show abstract
8612850	Endometrio sis			25 (17 women wi th endometriosi s, 8 fertile co ntrols undergoi ng tubal ligati on)		TNF alpha IL-8 IL-10	Show abstract
23025883	Endometrio sis (ovari an)			219 (112 with e ndometriosis, 1 07 without endo metriosis)		IL-10 IL-19 IL-20 IL-22	Show abstract
28300844	Endometrio sis					IL10 IL27 IL6 and TGFB1	Show abstract
28004192	Endometrio sis	IL-10 (592A/C and 819T/C)					Show abstract