Endometriosis Knowledgebase

Search Result

Gene id

3589

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL11 Gene UCSC Ensembl

Aliases

AGIF, IL-11

Gene name

interleukin 11

Alternate names

interleukin-11, adipogenesis inhibitory factor, oprelvekin,

Gene location

19q13.42 (55370462: 55364381) Exons: 5 NC_000019.10

Gene summary(Entrez)

The protein encoded by this gene is a member of the gp130 family of cytokines. These cytokines drive the assembly of multisubunit receptor complexes, all of which contain at least one molecule of the transmembrane signaling receptor IL6ST (gp130). This cytokine is shown to stimulate the T-cell-dependent development of immunoglobulin-producing B cells. It is also found to support the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jun 2012]

OMIM

147681

Protein Summary

Protein general information

P20809

Name: Interleukin 11 (IL 11) (Adipogenesis inhibitory factor) (AGIF) (Oprelvekin)

Length: 199 Mass: 21,429

Sequence

MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSL
PTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALP
QPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Structural information

Interpro:	IPR009079 IPR020438 IPR020412
Pfam:	PF07400
PDB:	4MHL
PDBsum:	4MHL
DIP:	3775
MINT:	1470864
STRING:	ENSP00000264563;

Other Databases

GeneCards: IL11; Malacards: IL11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005142	interleukin-11 receptor b inding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IC	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0007267	cell-cell signaling	IC	biological_process
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0030183	B cell differentiation	NAS	biological_process
GO:0030219	megakaryocyte differentia tion	NAS	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0045444	fat cell differentiation	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046888	negative regulation of ho rmone secretion	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:1903659	regulation of complement- dependent cytotoxicity	IMP	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IMP	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005142	interleukin-11 receptor b inding	IEA	molecular_function
GO:0005142	interleukin-11 receptor b inding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IC	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0007267	cell-cell signaling	IC	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0030183	B cell differentiation	NAS	biological_process
GO:0030219	megakaryocyte differentia tion	NAS	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0045444	fat cell differentiation	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046888	negative regulation of ho rmone secretion	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:1903659	regulation of complement- dependent cytotoxicity	IMP	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IMP	biological_process
GO:0005125	cytokine activity	IBA	molecular_function
GO:0005142	interleukin-11 receptor b inding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IC	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005737	cytoplasm	IBA	cellular_component
GO:0007267	cell-cell signaling	IC	biological_process
GO:0008083	growth factor activity	IDA	molecular_function
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0030183	B cell differentiation	NAS	biological_process
GO:0030219	megakaryocyte differentia tion	NAS	biological_process
GO:0033138	positive regulation of pe ptidyl-serine phosphoryla tion	IDA	biological_process
GO:0043410	positive regulation of MA PK cascade	IDA	biological_process
GO:0045444	fat cell differentiation	NAS	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046888	negative regulation of ho rmone secretion	IDA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IDA	biological_process
GO:1903659	regulation of complement- dependent cytotoxicity	IMP	biological_process
GO:2000352	negative regulation of en dothelial cell apoptotic process	IMP	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa05323  Rheumatoid arthritis
hsa04640  Hematopoietic cell lineage

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 19141999
Blocking implantation	PMID: 19213836
Chronic endometritis	PMID: 23351011
Chronic obstructive pulmonary disease (COPD)	PMID: 15004839
Crohn's disease	PMID: 12486609
Decidualization	PMID: 15613426
Endometrial cancer	PMID: 22614117
Endometriosis	PMID: 16310857
Female infertility	PMID: 24635366
Lower implantation	PMID: 16705074
Pelvic endometriosis	PMID: 11119747
Polycystic ovary syndrome (PCOS)	PMID: 11574494
Endometriosis associated infertility	INFBASE16310857
Endometriosis	INFBASE16310857
Pelvic endometriosis	INFBASE11119747
Ulcerative colitis	PMID: 12486609
Unexplained female infertility	PMID: 18047677

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
16310857	Endometrio sis	15 (8 controls, 7 patients wit h endometriosis )	Female infertility	IL-11 IL-11Ralpha and LIF	Show abstract
8550748	Endometrio sis	21 (14 patients with histologi cally documente d pelvic endome triosis, 7 norm al endometrial tissues)		IL-6 IL-11 P450arom	Show abstract
11119747	Endometrio sis (Pelvi c)	60 women underg oing laparoscop ic surgery for benign gynecolo gical indicatio ns		IL-11	Show abstract