Endometriosis Knowledgebase

Search Result

Gene id

3592

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL12A Gene UCSC Ensembl

Aliases

CLMF, IL-12A, NFSK, NKSF1, P35

Gene name

interleukin 12A

Alternate names

interleukin-12 subunit alpha, CLMF p35, IL-12, subunit p35, IL35 subunit, NF cell stimulatory factor chain 1, NK cell stimulatory factor chain 1, cytotoxic lymphocyte maturation factor 1, p35, cytotoxic lymphocyte maturation factor 35 kDa subunit, interleukin 12,,

Gene location

3q25.33 (159988835: 159996018) Exons: 7 NC_000003.12

Gene summary(Entrez)

This gene encodes a subunit of a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-independent induction of interferon (IFN)-gamma, and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity. [provided by RefSeq, Jul 2008]

OMIM

161560

Protein Summary

Protein general information

P29459

Name: Interleukin 12 subunit alpha (IL 12A) (Cytotoxic lymphocyte maturation factor 35 kDa subunit) (CLMF p35) (IL 12 subunit p35) (NK cell stimulatory factor chain 1) (NKSF1)

Length: 219 Mass: 24,874

Sequence

MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDIT
KDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPK
RQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS

Structural information

Interpro:	IPR009079 IPR004281
Pfam:	PF03039
PDB:	1F45 3HMX
PDBsum:	1F45 3HMX
DIP:	3772
STRING:	ENSP00000303231;

Other Databases

GeneCards: IL12A; Malacards: IL12A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001916	positive regulation of T cell mediated cytotoxicit y	IDA	biological_process
GO:0001916	positive regulation of T cell mediated cytotoxicit y	IDA	biological_process
GO:0002860	positive regulation of na tural killer cell mediate d cytotoxicity directed a gainst tumor cell target	IDA	biological_process
GO:0005143	interleukin-12 receptor b inding	IBA	molecular_function
GO:0005143	interleukin-12 receptor b inding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006955	immune response	TAS	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0010224	response to UV-B	IDA	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032700	negative regulation of in terleukin-17 production	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032816	positive regulation of na tural killer cell activat ion	IDA	biological_process
GO:0032946	positive regulation of mo nonuclear cell proliferat ion	IMP	biological_process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	IDA	biological_process
GO:0042102	positive regulation of T cell proliferation	IBA	biological_process
GO:0042163	interleukin-12 beta subun it binding	IPI	molecular_function
GO:0042520	positive regulation of ty rosine phosphorylation of Stat4 protein	IDA	biological_process
GO:0042832	defense response to proto zoan	IEA	biological_process
GO:0043514	interleukin-12 complex	IDA	cellular_component
GO:0043514	interleukin-12 complex	IDA	cellular_component
GO:0043514	interleukin-12 complex	NAS	cellular_component
GO:0043514	interleukin-12 complex	NAS	cellular_component
GO:0043514	interleukin-12 complex	IDA	cellular_component
GO:0045513	interleukin-27 binding	IPI	molecular_function
GO:0045582	positive regulation of T cell differentiation	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IDA	biological_process
GO:0045954	positive regulation of na tural killer cell mediate d cytotoxicity	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050671	positive regulation of ly mphocyte proliferation	IDA	biological_process
GO:0050671	positive regulation of ly mphocyte proliferation	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IEP	biological_process
GO:0051135	positive regulation of NK T cell activation	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0098586	cellular response to viru s	IMP	biological_process
GO:2000510	positive regulation of de ndritic cell chemotaxis	IMP	biological_process
GO:0005125	cytokine activity	TAS	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0008083	growth factor activity	NAS	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0001916	positive regulation of T cell mediated cytotoxicit y	IDA	biological_process
GO:0001916	positive regulation of T cell mediated cytotoxicit y	IDA	biological_process
GO:0002860	positive regulation of na tural killer cell mediate d cytotoxicity directed a gainst tumor cell target	IDA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005143	interleukin-12 receptor b inding	IEA	molecular_function
GO:0005143	interleukin-12 receptor b inding	IBA	molecular_function
GO:0005143	interleukin-12 receptor b inding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006955	immune response	IEA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0009615	response to virus	IEP	biological_process
GO:0010224	response to UV-B	IDA	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032700	negative regulation of in terleukin-17 production	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IEA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032816	positive regulation of na tural killer cell activat ion	IDA	biological_process
GO:0032946	positive regulation of mo nonuclear cell proliferat ion	IMP	biological_process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	IDA	biological_process
GO:0042102	positive regulation of T cell proliferation	IEA	biological_process
GO:0042102	positive regulation of T cell proliferation	IBA	biological_process
GO:0042163	interleukin-12 beta subun it binding	IEA	molecular_function
GO:0042163	interleukin-12 beta subun it binding	IPI	molecular_function
GO:0042520	positive regulation of ty rosine phosphorylation of Stat4 protein	IDA	biological_process
GO:0042832	defense response to proto zoan	IEA	biological_process
GO:0043514	interleukin-12 complex	IEA	cellular_component
GO:0043514	interleukin-12 complex	IDA	cellular_component
GO:0043514	interleukin-12 complex	IDA	cellular_component
GO:0043514	interleukin-12 complex	NAS	cellular_component
GO:0043514	interleukin-12 complex	NAS	cellular_component
GO:0043514	interleukin-12 complex	IDA	cellular_component
GO:0045513	interleukin-27 binding	IPI	molecular_function
GO:0045582	positive regulation of T cell differentiation	IEA	biological_process
GO:0045785	positive regulation of ce ll adhesion	IDA	biological_process
GO:0045954	positive regulation of na tural killer cell mediate d cytotoxicity	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050671	positive regulation of ly mphocyte proliferation	IDA	biological_process
GO:0050671	positive regulation of ly mphocyte proliferation	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IEP	biological_process
GO:0051135	positive regulation of NK T cell activation	IDA	biological_process
GO:0071222	cellular response to lipo polysaccharide	IEA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0098586	cellular response to viru s	IMP	biological_process
GO:2000510	positive regulation of de ndritic cell chemotaxis	IMP	biological_process
GO:0005125	cytokine activity	TAS	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0008083	growth factor activity	NAS	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function
GO:0001916	positive regulation of T cell mediated cytotoxicit y	IDA	biological_process
GO:0001916	positive regulation of T cell mediated cytotoxicit y	IDA	biological_process
GO:0002860	positive regulation of na tural killer cell mediate d cytotoxicity directed a gainst tumor cell target	IDA	biological_process
GO:0005143	interleukin-12 receptor b inding	IBA	molecular_function
GO:0005143	interleukin-12 receptor b inding	NAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IDA	cellular_component
GO:0006955	immune response	TAS	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0009615	response to virus	IEP	biological_process
GO:0010224	response to UV-B	IDA	biological_process
GO:0016477	cell migration	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032496	response to lipopolysacch aride	IDA	biological_process
GO:0032700	negative regulation of in terleukin-17 production	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032729	positive regulation of in terferon-gamma production	IDA	biological_process
GO:0032816	positive regulation of na tural killer cell activat ion	IDA	biological_process
GO:0032946	positive regulation of mo nonuclear cell proliferat ion	IMP	biological_process
GO:0034393	positive regulation of sm ooth muscle cell apoptoti c process	IDA	biological_process
GO:0042102	positive regulation of T cell proliferation	IBA	biological_process
GO:0042163	interleukin-12 beta subun it binding	IPI	molecular_function
GO:0042520	positive regulation of ty rosine phosphorylation of Stat4 protein	IDA	biological_process
GO:0043514	interleukin-12 complex	IDA	cellular_component
GO:0043514	interleukin-12 complex	IDA	cellular_component
GO:0043514	interleukin-12 complex	NAS	cellular_component
GO:0043514	interleukin-12 complex	NAS	cellular_component
GO:0043514	interleukin-12 complex	IDA	cellular_component
GO:0045513	interleukin-27 binding	IPI	molecular_function
GO:0045785	positive regulation of ce ll adhesion	IDA	biological_process
GO:0045954	positive regulation of na tural killer cell mediate d cytotoxicity	IDA	biological_process
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0046982	protein heterodimerizatio n activity	IPI	molecular_function
GO:0048662	negative regulation of sm ooth muscle cell prolifer ation	IDA	biological_process
GO:0050671	positive regulation of ly mphocyte proliferation	IDA	biological_process
GO:0050671	positive regulation of ly mphocyte proliferation	IDA	biological_process
GO:0050830	defense response to Gram- positive bacterium	IEP	biological_process
GO:0051135	positive regulation of NK T cell activation	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:0098586	cellular response to viru s	IMP	biological_process
GO:2000510	positive regulation of de ndritic cell chemotaxis	IMP	biological_process
GO:0005125	cytokine activity	TAS	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0008083	growth factor activity	NAS	molecular_function
GO:0008083	growth factor activity	IDA	molecular_function

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa05152  Tuberculosis
hsa05168  Herpes simplex infection
hsa05164  Influenza A
hsa04630  Jak-STAT signaling pathway
hsa05145  Toxoplasmosis
hsa05142  Chagas disease
hsa05162  Measles
hsa05321  Inflammatory bowel disease
hsa04620  Toll-like receptor signaling pathway
hsa05146  Amoebiasis
hsa04658  Th1 and Th2 cell differentiation
hsa05140  Leishmaniasis
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05144  Malaria
hsa05330  Allograft rejection
hsa04940  Type I diabetes mellitus
hsa05143  African trypanosomiasis
hsa04622  RIG-I-like receptor signaling pathway

Diseases

Associated diseases	References
Aphthous stomatitis	PMID: 14629328
Arthritis	PMID: 11981324
Asthma	PMID: 14962816
Atopic dermatitis	PMID: 20060272
Biliary primary cirrhosis	PMID: 19458352
Cancer	PMID: 14675394
Celiac disease	PMID: 18805825
Chronic obstructive pulmonary disease (COPD)	PMID: 19625176
Common variable immunodeficiency	PMID: 19339796
Diabetes	PMID: 19073967
Endometriosis	PMID: 18295214
Graves ophthalmopathy	PMID: 19798110
Immune infertility	PMID: 9639047
Implantation failure	PMID: 14711545
Juvenile arthritis	PMID: 15170937
Leukocytospermia	PMID: 9730437
Male infertility	PMID: 11476770
Multiple sclerosis	PMID: 16803996
Myasthenia gravis	PMID: 17509455
Osteoarthritis	PMID: 12421093
Ovarian hyperstimulation syndrome(OHSS)	PMID: 26823856
Pemphigus	PMID: 19470040
Polycystic ovary syndrome (PCOS)	PMID: 12798884
Endometriosis	INFBASE9436700
Preeclampsia	PMID: 23082474
Psoriasis	PMID: 17236132
Recurrent miscarriage	PMID: 26368793
Unexplained infertility	PMID: 25032981

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
18295214	Endometrio sis	105 (72 endomet riosis patients , 33 controls)	Female infertility	IL-12 IL-18	Show abstract
15255283	Endometrio sis	80 women while they were under going laparosco py for pain,inf ertility, tubal ligation or re -anastomosis		IL-12 IL-13	Show abstract
9506747	Endometrio sis	73 (33 patients with endometri osis, 40 women without laparos copic evidence of the disease)		IL-12 p40	Show abstract
9436700	Endometrio sis			IL-10 IL-5 IL-12	Show abstract