Endometriosis Knowledgebase


A repository for genes associated with endometriosis

Search Result


Gene id 3593
Gene Summary        Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed references    

Gene Summary

Gene Symbol IL12B   Gene   UCSC   Ensembl
Aliases CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2
Gene name interleukin 12B
Alternate names interleukin-12 subunit beta, CLMF p40, IL-12 subunit p40, IL12, subunit p40, NK cell stimulatory factor chain 2, cytotoxic lymphocyte maturation factor 40 kDa subunit, interleukin 12, p40, interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40), interleukin-12 beta chain, natural killer cell stimulatory factor, 40 kD subunit,
Gene location 5q33.3 (159330472: 159314782)     Exons: 8     NC_000005.10
Gene summary(Entrez) This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. [provided by RefSeq, Jul 2008]
OMIM 161561

Protein Summary

Protein general information P29460  

Name: Interleukin-12 subunit beta (IL-12B) (Cytotoxic lymphocyte maturation factor 40 kDa subunit) (CLMF p40) (IL-12 subunit p40) (NK cell stimulatory factor chain 2) (NKSF2)

Length: 328  Mass: 37,169

Sequence MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTL
TIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIST
DLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTS
SFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS
Structural information
Protein Domains
Ig-like (23-106)
Fibronectin (237-328)
Interpro:  IPR003961 IPR036116 IPR003530 IPR007110 IPR036179 IPR013783 IPR003598 IPR015528 IPR019482
Prosite:   PS50853 PS01354 PS50835

Pfam:  
PF10420
CDD:   cd00063

PDB:  
1F42 1F45 3D85 3D87 3DUH 3HMX 3QWR 4GRW 5MJ3 5MJ4 5MXA 5MZV 5NJD
PDBsum:   1F42 1F45 3D85 3D87 3DUH 3HMX 3QWR 4GRW 5MJ3 5MJ4 5MXA 5MZV 5NJD

DIP:  
3774
STRING:   ENSP00000231228;
Other Databases GeneCards:  IL12B;  Malacards:  IL12B

Gene ontology


GO accessionTerm nameEvidence codeGo category
GO:0001916 positive regulation of T
cell mediated cytotoxicit
y
ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
IDA biological_process
GO:0002323 natural killer cell activ
ation involved in immune
response
IEA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
ISS biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
IDA biological_process
GO:0002860 positive regulation of na
tural killer cell mediate
d cytotoxicity directed a
gainst tumor cell target
IDA biological_process
GO:0002862 negative regulation of in
flammatory response to an
tigenic stimulus
IEA biological_process
GO:0004896 cytokine receptor activit
y
IEA molecular_function
GO:0005143 interleukin-12 receptor b
inding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0007050 cell cycle arrest
IDA biological_process
GO:0010224 response to UV-B
IDA biological_process
GO:0010535 positive regulation of ac
tivation of JAK2 kinase a
ctivity
IDA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016477 cell migration
IDA biological_process
GO:0019221 cytokine-mediated signali
ng pathway
IEA biological_process
GO:0019233 sensory perception of pai
n
IEA biological_process
GO:0019953 sexual reproduction
TAS biological_process
GO:0030101 natural killer cell activ
ation
IDA biological_process
GO:0032693 negative regulation of in
terleukin-10 production
IMP biological_process
GO:0032700 negative regulation of in
terleukin-17 production
IDA biological_process
GO:0032725 positive regulation of gr
anulocyte macrophage colo
ny-stimulating factor pro
duction
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
TAS biological_process
GO:0032735 positive regulation of in
terleukin-12 production
IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological_process
GO:0032760 positive regulation of tu
mor necrosis factor produ
ction
IMP biological_process
GO:0032816 positive regulation of na
tural killer cell activat
ion
IDA biological_process
GO:0032816 positive regulation of na
tural killer cell activat
ion
IC biological_process
GO:0032819 positive regulation of na
tural killer cell prolife
ration
IDA biological_process
GO:0032946 positive regulation of mo
nonuclear cell proliferat
ion
IMP biological_process
GO:0034105 positive regulation of ti
ssue remodeling
IC biological_process
GO:0034393 positive regulation of sm
ooth muscle cell apoptoti
c process
IDA biological_process
GO:0042035 regulation of cytokine bi
osynthetic process
TAS biological_process
GO:0042088 T-helper 1 type immune re
sponse
TAS biological_process
GO:0042093 T-helper cell differentia
tion
IDA biological_process
GO:0042095 interferon-gamma biosynth
etic process
TAS biological_process
GO:0042102 positive regulation of T
cell proliferation
IDA biological_process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological_process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological_process
GO:0042164 interleukin-12 alpha subu
nit binding
IPI molecular_function
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
TAS biological_process
GO:0042510 regulation of tyrosine ph
osphorylation of Stat1 pr
otein
IDA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
IDA biological_process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
IDA biological_process
GO:0042802 identical protein binding
IPI molecular_function
GO:0042803 protein homodimerization
activity
IEA molecular_function
GO:0042832 defense response to proto
zoan
IEA biological_process
GO:0043382 positive regulation of me
mory T cell differentiati
on
ISS biological_process
GO:0043514 interleukin-12 complex
IDA cellular_component
GO:0043514 interleukin-12 complex
IDA cellular_component
GO:0044130 negative regulation of gr
owth of symbiont in host
IEA biological_process
GO:0045078 positive regulation of in
terferon-gamma biosynthet
ic process
TAS biological_process
GO:0045672 positive regulation of os
teoclast differentiation
IDA biological_process
GO:0045785 positive regulation of ce
ll adhesion
IDA biological_process
GO:0046982 protein heterodimerizatio
n activity
IPI molecular_function
GO:0046982 protein heterodimerizatio
n activity
IPI molecular_function
GO:0048662 negative regulation of sm
ooth muscle cell prolifer
ation
IDA biological_process
GO:0050671 positive regulation of ly
mphocyte proliferation
IDA biological_process
GO:0050729 positive regulation of in
flammatory response
IC biological_process
GO:0050829 defense response to Gram-
negative bacterium
IDA biological_process
GO:0050829 defense response to Gram-
negative bacterium
IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
IC biological_process
GO:0051142 positive regulation of NK
T cell proliferation
IDA biological_process
GO:0051607 defense response to virus
IEA biological_process
GO:0070743 interleukin-23 complex
IDA cellular_component
GO:0071222 cellular response to lipo
polysaccharide
IEA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IEA biological_process
GO:2000318 positive regulation of T-
helper 17 type immune res
ponse
ISS biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
ISS biological_process
GO:0005125 cytokine activity
IDA molecular_function
GO:0005143 interleukin-12 receptor b
inding
TAS molecular_function
GO:0008083 growth factor activity
IDA molecular_function
GO:0045519 interleukin-23 receptor b
inding
IDA molecular_function
GO:0001916 positive regulation of T
cell mediated cytotoxicit
y
IEA biological_process
GO:0001916 positive regulation of T
cell mediated cytotoxicit
y
ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
IEA biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
IDA biological_process
GO:0002323 natural killer cell activ
ation involved in immune
response
IEA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
IEA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
ISS biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
IDA biological_process
GO:0002860 positive regulation of na
tural killer cell mediate
d cytotoxicity directed a
gainst tumor cell target
IDA biological_process
GO:0002862 negative regulation of in
flammatory response to an
tigenic stimulus
IEA biological_process
GO:0004896 cytokine receptor activit
y
IEA molecular_function
GO:0005125 cytokine activity
IEA molecular_function
GO:0005125 cytokine activity
IEA molecular_function
GO:0005126 cytokine receptor binding
IEA molecular_function
GO:0005143 interleukin-12 receptor b
inding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
IEA cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
IEA cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0005737 cytoplasm
IEA cellular_component
GO:0007050 cell cycle arrest
IDA biological_process
GO:0007166 cell surface receptor sig
naling pathway
IEA biological_process
GO:0010033 response to organic subst
ance
IEA biological_process
GO:0010224 response to UV-B
IDA biological_process
GO:0010535 positive regulation of ac
tivation of JAK2 kinase a
ctivity
IDA biological_process
GO:0016020 membrane
IEA cellular_component
GO:0016477 cell migration
IDA biological_process
GO:0019221 cytokine-mediated signali
ng pathway
IEA biological_process
GO:0019233 sensory perception of pai
n
IEA biological_process
GO:0019953 sexual reproduction
TAS biological_process
GO:0030101 natural killer cell activ
ation
IDA biological_process
GO:0032693 negative regulation of in
terleukin-10 production
IMP biological_process
GO:0032700 negative regulation of in
terleukin-17 production
IDA biological_process
GO:0032725 positive regulation of gr
anulocyte macrophage colo
ny-stimulating factor pro
duction
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IEA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
TAS biological_process
GO:0032735 positive regulation of in
terleukin-12 production
IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological_process
GO:0032760 positive regulation of tu
mor necrosis factor produ
ction
IMP biological_process
GO:0032816 positive regulation of na
tural killer cell activat
ion
IDA biological_process
GO:0032816 positive regulation of na
tural killer cell activat
ion
IC biological_process
GO:0032819 positive regulation of na
tural killer cell prolife
ration
IDA biological_process
GO:0032946 positive regulation of mo
nonuclear cell proliferat
ion
IMP biological_process
GO:0034105 positive regulation of ti
ssue remodeling
IC biological_process
GO:0034393 positive regulation of sm
ooth muscle cell apoptoti
c process
IDA biological_process
GO:0042035 regulation of cytokine bi
osynthetic process
TAS biological_process
GO:0042088 T-helper 1 type immune re
sponse
TAS biological_process
GO:0042093 T-helper cell differentia
tion
IDA biological_process
GO:0042095 interferon-gamma biosynth
etic process
TAS biological_process
GO:0042102 positive regulation of T
cell proliferation
IEA biological_process
GO:0042102 positive regulation of T
cell proliferation
IDA biological_process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological_process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological_process
GO:0042164 interleukin-12 alpha subu
nit binding
IEA molecular_function
GO:0042164 interleukin-12 alpha subu
nit binding
IPI molecular_function
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
TAS biological_process
GO:0042510 regulation of tyrosine ph
osphorylation of Stat1 pr
otein
IDA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
IDA biological_process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
IDA biological_process
GO:0042802 identical protein binding
IPI molecular_function
GO:0042803 protein homodimerization
activity
IEA molecular_function
GO:0042832 defense response to proto
zoan
IEA biological_process
GO:0043382 positive regulation of me
mory T cell differentiati
on
ISS biological_process
GO:0043514 interleukin-12 complex
IEA cellular_component
GO:0043514 interleukin-12 complex
IDA cellular_component
GO:0043514 interleukin-12 complex
IDA cellular_component
GO:0044130 negative regulation of gr
owth of symbiont in host
IEA biological_process
GO:0045078 positive regulation of in
terferon-gamma biosynthet
ic process
TAS biological_process
GO:0045672 positive regulation of os
teoclast differentiation
IDA biological_process
GO:0045785 positive regulation of ce
ll adhesion
IDA biological_process
GO:0046982 protein heterodimerizatio
n activity
IEA molecular_function
GO:0046982 protein heterodimerizatio
n activity
IPI molecular_function
GO:0046982 protein heterodimerizatio
n activity
IPI molecular_function
GO:0048662 negative regulation of sm
ooth muscle cell prolifer
ation
IDA biological_process
GO:0050671 positive regulation of ly
mphocyte proliferation
IDA biological_process
GO:0050729 positive regulation of in
flammatory response
IC biological_process
GO:0050829 defense response to Gram-
negative bacterium
IDA biological_process
GO:0050829 defense response to Gram-
negative bacterium
IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
IC biological_process
GO:0051142 positive regulation of NK
T cell proliferation
IDA biological_process
GO:0051607 defense response to virus
IEA biological_process
GO:0070743 interleukin-23 complex
IEA cellular_component
GO:0070743 interleukin-23 complex
IDA cellular_component
GO:0071222 cellular response to lipo
polysaccharide
IEA biological_process
GO:0071346 cellular response to inte
rferon-gamma
IEA biological_process
GO:2000318 positive regulation of T-
helper 17 type immune res
ponse
ISS biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
ISS biological_process
GO:0005125 cytokine activity
IDA molecular_function
GO:0005143 interleukin-12 receptor b
inding
TAS molecular_function
GO:0008083 growth factor activity
IDA molecular_function
GO:0045519 interleukin-23 receptor b
inding
IDA molecular_function
GO:0001916 positive regulation of T
cell mediated cytotoxicit
y
ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
ISS biological_process
GO:0002230 positive regulation of de
fense response to virus b
y host
IDA biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
ISS biological_process
GO:0002827 positive regulation of T-
helper 1 type immune resp
onse
IDA biological_process
GO:0002860 positive regulation of na
tural killer cell mediate
d cytotoxicity directed a
gainst tumor cell target
IDA biological_process
GO:0005143 interleukin-12 receptor b
inding
TAS molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005515 protein binding
IPI molecular_function
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005576 extracellular region
TAS cellular_component
GO:0005615 extracellular space
TAS cellular_component
GO:0007050 cell cycle arrest
IDA biological_process
GO:0010224 response to UV-B
IDA biological_process
GO:0010535 positive regulation of ac
tivation of JAK2 kinase a
ctivity
IDA biological_process
GO:0016477 cell migration
IDA biological_process
GO:0019953 sexual reproduction
TAS biological_process
GO:0030101 natural killer cell activ
ation
IDA biological_process
GO:0032693 negative regulation of in
terleukin-10 production
IMP biological_process
GO:0032700 negative regulation of in
terleukin-17 production
IDA biological_process
GO:0032725 positive regulation of gr
anulocyte macrophage colo
ny-stimulating factor pro
duction
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032729 positive regulation of in
terferon-gamma production
IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
IDA biological_process
GO:0032733 positive regulation of in
terleukin-10 production
TAS biological_process
GO:0032735 positive regulation of in
terleukin-12 production
IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological_process
GO:0032740 positive regulation of in
terleukin-17 production
IDA biological_process
GO:0032760 positive regulation of tu
mor necrosis factor produ
ction
IMP biological_process
GO:0032816 positive regulation of na
tural killer cell activat
ion
IDA biological_process
GO:0032816 positive regulation of na
tural killer cell activat
ion
IC biological_process
GO:0032819 positive regulation of na
tural killer cell prolife
ration
IDA biological_process
GO:0032946 positive regulation of mo
nonuclear cell proliferat
ion
IMP biological_process
GO:0034105 positive regulation of ti
ssue remodeling
IC biological_process
GO:0034393 positive regulation of sm
ooth muscle cell apoptoti
c process
IDA biological_process
GO:0042035 regulation of cytokine bi
osynthetic process
TAS biological_process
GO:0042088 T-helper 1 type immune re
sponse
TAS biological_process
GO:0042093 T-helper cell differentia
tion
IDA biological_process
GO:0042095 interferon-gamma biosynth
etic process
TAS biological_process
GO:0042102 positive regulation of T
cell proliferation
IDA biological_process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological_process
GO:0042104 positive regulation of ac
tivated T cell proliferat
ion
IDA biological_process
GO:0042164 interleukin-12 alpha subu
nit binding
IPI molecular_function
GO:0042346 positive regulation of NF
-kappaB import into nucle
us
TAS biological_process
GO:0042510 regulation of tyrosine ph
osphorylation of Stat1 pr
otein
IDA biological_process
GO:0042517 positive regulation of ty
rosine phosphorylation of
Stat3 protein
IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
IDA biological_process
GO:0042520 positive regulation of ty
rosine phosphorylation of
Stat4 protein
IDA biological_process
GO:0042523 positive regulation of ty
rosine phosphorylation of
Stat5 protein
IDA biological_process
GO:0042802 identical protein binding
IPI molecular_function
GO:0043382 positive regulation of me
mory T cell differentiati
on
ISS biological_process
GO:0043514 interleukin-12 complex
IDA cellular_component
GO:0043514 interleukin-12 complex
IDA cellular_component
GO:0045078 positive regulation of in
terferon-gamma biosynthet
ic process
TAS biological_process
GO:0045672 positive regulation of os
teoclast differentiation
IDA biological_process
GO:0045785 positive regulation of ce
ll adhesion
IDA biological_process
GO:0046982 protein heterodimerizatio
n activity
IPI molecular_function
GO:0046982 protein heterodimerizatio
n activity
IPI molecular_function
GO:0048662 negative regulation of sm
ooth muscle cell prolifer
ation
IDA biological_process
GO:0050671 positive regulation of ly
mphocyte proliferation
IDA biological_process
GO:0050729 positive regulation of in
flammatory response
IC biological_process
GO:0050829 defense response to Gram-
negative bacterium
IDA biological_process
GO:0050829 defense response to Gram-
negative bacterium
IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
IDA biological_process
GO:0051135 positive regulation of NK
T cell activation
IC biological_process
GO:0051142 positive regulation of NK
T cell proliferation
IDA biological_process
GO:0070743 interleukin-23 complex
IDA cellular_component
GO:2000318 positive regulation of T-
helper 17 type immune res
ponse
ISS biological_process
GO:2000330 positive regulation of T-
helper 17 cell lineage co
mmitment
ISS biological_process
GO:0005125 cytokine activity
IDA molecular_function
GO:0005143 interleukin-12 receptor b
inding
TAS molecular_function
GO:0008083 growth factor activity
IDA molecular_function
GO:0045519 interleukin-23 receptor b
inding
IDA molecular_function

Diseases

Associated diseases References
Endometriosis PMID: 27491770
Endometriosis PMID: 27491770
Endometriosis INFBASE27491770

PubMed references


PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
27491770 Endometrio
sis

340 (200 women
with advanced s
tage endometrio
sis, 140 normal
ovulating wome
n with tubal fa
ctor infertilit
y (without endo
metriosis))
Female infertility IL1B
TNFA
IL2
IL8
IL12
IFNG
IL4
IL6
IL10
VEGF
ADM
angiogenin
Show abstract