Endometriosis Knowledgebase

Search Result

Gene id

3605

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

IL17A Gene UCSC Ensembl

Aliases

CTLA-8, CTLA8, IL-17, IL-17A, IL17

Gene name

interleukin 17A

Alternate names

interleukin-17A, cytotoxic T-lymphocyte-associated antigen 8, cytotoxic T-lymphocyte-associated protein 8, interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8),

Gene location

6p12.2 (52186386: 52190637) Exons: 3 NC_000006.12

Gene summary(Entrez)

The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq, Jul 2008]

OMIM

603149

Protein Summary

Protein general information

Q16552

Name: Interleukin 17A (IL 17) (IL 17A) (Cytotoxic T lymphocyte associated antigen 8) (CTLA 8)

Length: 155 Mass: 17,504

Tissue specificity: Restricted to activated memory T-cells.

Sequence

MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWN
LHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPI
VHHVA

Structural information

Interpro:	IPR029034 IPR020440 IPR010345
Pfam:	PF06083
PDB:	2VXS 4HR9 4HSA 4QHU 5HHV 5HHX 5HI3 5HI4 5HI5
PDBsum:	2VXS 4HR9 4HSA 4QHU 5HHV 5HHX 5HI3 5HI4 5HI5
DIP:	6014
STRING:	ENSP00000344192;

Other Databases

GeneCards: IL17A; Malacards: IL17A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005126	cytokine receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008219	cell death	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010940	positive regulation of ne crotic cell death	IEA	biological_process
GO:0032747	positive regulation of in terleukin-23 production	IDA	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0050832	defense response to fungu s	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071385	cellular response to gluc ocorticoid stimulus	IEA	biological_process
GO:0072537	fibroblast activation	IDA	biological_process
GO:1900017	positive regulation of cy tokine production involve d in inflammatory respons e	IEA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IEA	biological_process
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	IEA	molecular_function
GO:0005125	cytokine activity	TAS	molecular_function
GO:0005126	cytokine receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IEA	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008219	cell death	TAS	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0010940	positive regulation of ne crotic cell death	IEA	biological_process
GO:0032747	positive regulation of in terleukin-23 production	IDA	biological_process
GO:0043200	response to amino acid	IEA	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0050832	defense response to fungu s	IEA	biological_process
GO:0071347	cellular response to inte rleukin-1	IEA	biological_process
GO:0071385	cellular response to gluc ocorticoid stimulus	IEA	biological_process
GO:0072537	fibroblast activation	IDA	biological_process
GO:1900017	positive regulation of cy tokine production involve d in inflammatory respons e	IEA	biological_process
GO:2000778	positive regulation of in terleukin-6 secretion	IEA	biological_process
GO:0005125	cytokine activity	TAS	molecular_function
GO:0005126	cytokine receptor binding	IBA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	TAS	cellular_component
GO:0006915	apoptotic process	TAS	biological_process
GO:0006954	inflammatory response	IBA	biological_process
GO:0006955	immune response	TAS	biological_process
GO:0007166	cell surface receptor sig naling pathway	IBA	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0008219	cell death	TAS	biological_process
GO:0032747	positive regulation of in terleukin-23 production	IDA	biological_process
GO:0045672	positive regulation of os teoclast differentiation	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0072537	fibroblast activation	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04659  Th17 cell differentiation
hsa04657  IL-17 signaling pathway
hsa05323  Rheumatoid arthritis
hsa05321  Inflammatory bowel disease

Diseases

Associated diseases	References
Asthma	PMID: 19210369
Cancer	PMID: 19904747
Endometrial cancer	PMID: 26744532
Endometriosis	PMID: 16008887
Gastric mucosa	PMID: 19724898
Multiple sclerosis	PMID: 18563468
Endometriosis	INFBASE25772772
Polycystic ovary syndrome (PCOS)	PMID: 24927491
Polycystic ovary syndrome (PCOS)	INFBASE24927491
Endometrioma	INFBASE20074813
Varicocele	INFBASE24927491
Endometriosis associated infertility	INFBASE16045534
Endometriosis	INFBASE16008887
Rheumatoid arthritis	PMID: 19208686
Unexplained infertility	PMID: 24368037

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
26259585	Endometrio sis			G-CSF CXCL12 CXCL1 VEGF IL-8 CX3CL1	Show abstract
16008887	Endometrio sis	62 (36 patients with different stage endometr iosis, 26 patie nts without end ometriosis)	Female infertility	IL-17	Show abstract
20074813	Endometrio sis			IL-6 IL-8 IL-13 IL-17 and CA-125	Show abstract
16045534	Endometrio sis		Female infertility		Show abstract
18079209	Endometrio sis			IL-17A	Show abstract
24927491	Endometrio sis	47 (8 tubal fac tor, 10 severe endometriosis, 8 PCOS, 9 contr ol women )	Male infertility, Female infertility		Show abstract
25772772	Endometrio sis	48 (24 women wi th peritoneal a nd/or ovarian e ndometriosis, 2 4 controls)		let-7b 7d 7f	Show abstract