Endometriosis Knowledgebase

Search Result

Gene id

362

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

AQP5 Gene UCSC Ensembl

Aliases

AQP-5, PPKB

Gene name

aquaporin 5

Alternate names

aquaporin-5,

Gene location

12q13.12 (49961495: 49965681) Exons: 5 NC_000012.12

Gene summary(Entrez)

Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13. [provided by RefSeq, Jul 2008]

OMIM

600442

Protein Summary

Protein general information

P55064

Name: Aquaporin 5 (AQP 5)

Length: 265 Mass: 28,292

Sequence

MKKEVCSVAFLKAVFAEFLATLIFVFFGLGSALKWPSALPTILQIALAFGLAIGTLAQALGPVSGGHINPAITLA
LLVGNQISLLRAFFYVAAQLVGAIAGAGILYGVAPLNARGNLAVNALNNNTTQGQAMVVELILTFQLALCIFAST
DSRRTSPVGSPALSIGLSVTLGHLVGIYFTGCSMNPARSFGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLL
FPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR

Structural information

Motifs	NPA 1(69-71) NPA 2.(185-187)
Interpro:	IPR023271 IPR023276 IPR034294 IPR000425 IPR022357
Prosite:	PS00221
Pfam:	PF00230
CDD:	cd00333
PDB:	3D9S 5C5X 5DYE
PDBsum:	3D9S 5C5X 5DYE
DIP:	46292
MINT:	1442891
STRING:	ENSP00000293599;

Other Databases

GeneCards: AQP5; Malacards: AQP5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005902	microvillus	IEA	cellular_component
GO:0006833	water transport	TAS	biological_process
GO:0007588	excretion	TAS	biological_process
GO:0009925	basal plasma membrane	IEA	cellular_component
GO:0009992	cellular water homeostasi s	IBA	biological_process
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	IDA	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015254	glycerol channel activity	IBA	molecular_function
GO:0015670	carbon dioxide transport	IDA	biological_process
GO:0015793	glycerol transport	IEA	biological_process
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0030157	pancreatic juice secretio n	IEP	biological_process
GO:0034220	ion transmembrane transpo rt	IBA	biological_process
GO:0042476	odontogenesis	IEP	biological_process
GO:0046541	saliva secretion	IEA	biological_process
GO:0048593	camera-type eye morphogen esis	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005215	transporter activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005783	endoplasmic reticulum	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005902	microvillus	IEA	cellular_component
GO:0006810	transport	IEA	biological_process
GO:0006810	transport	IEA	biological_process
GO:0006833	water transport	IEA	biological_process
GO:0006833	water transport	TAS	biological_process
GO:0006833	water transport	TAS	biological_process
GO:0007588	excretion	TAS	biological_process
GO:0009925	basal plasma membrane	IEA	cellular_component
GO:0009992	cellular water homeostasi s	IBA	biological_process
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	IDA	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	TAS	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015254	glycerol channel activity	IBA	molecular_function
GO:0015670	carbon dioxide transport	IEA	biological_process
GO:0015670	carbon dioxide transport	IDA	biological_process
GO:0015793	glycerol transport	IEA	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016324	apical plasma membrane	IEA	cellular_component
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0030157	pancreatic juice secretio n	IEP	biological_process
GO:0034220	ion transmembrane transpo rt	IBA	biological_process
GO:0042476	odontogenesis	IEP	biological_process
GO:0046541	saliva secretion	IEA	biological_process
GO:0048593	camera-type eye morphogen esis	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0006833	water transport	TAS	biological_process
GO:0006833	water transport	TAS	biological_process
GO:0007588	excretion	TAS	biological_process
GO:0009992	cellular water homeostasi s	IBA	biological_process
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	IDA	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	TAS	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015250	water channel activity	EXP	molecular_function
GO:0015254	glycerol channel activity	IBA	molecular_function
GO:0015670	carbon dioxide transport	IDA	biological_process
GO:0016324	apical plasma membrane	IDA	cellular_component
GO:0030157	pancreatic juice secretio n	IEP	biological_process
GO:0034220	ion transmembrane transpo rt	IBA	biological_process
GO:0042476	odontogenesis	IEP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component

KEGG pathways

hsa04970 Salivary secretion

Diseases

Associated diseases	References
Azoospermia	PMID: 17928628
Coronary artery disease	PMID: 18846354
Endometriosis	PMID: 19931078
Palmoplantar keratoderma	OMIM: 600442, KEGG: H01673
Endometriosis	INFBASE19931078

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
19931078	Endometrio sis			70 women with e ndometriomas		Aquaporins 2 5 8	Show abstract