Endometriosis Knowledgebase

Search Result

Gene id

3624

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

INHBA Gene UCSC Ensembl

Aliases

EDF, FRP

Gene name

inhibin beta A subunit

Alternate names

inhibin beta A chain, FSH-releasing protein, Inhibin, beta-1, activin beta-A chain, erythroid differentiation factor, erythroid differentiation protein, follicle-stimulating hormone-releasing protein, inhibin, beta A (activin A, activin AB alpha polypeptide),

Gene location

7p14.1 (41710531: 41685100) Exons: 7 NC_000007.14

Gene summary(Entrez)

This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients. [provided by RefSeq, Aug 2016]

OMIM

147290

Protein Summary

Protein general information

P08476

Name: Inhibin beta A chain (Activin beta A chain) (Erythroid differentiation protein) (EDF)

Length: 426 Mass: 47,442

Sequence

MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVT
QPVPKAALLNAIRKLHVGKVGENGYVEIEDDIGRRAEMNELMEQTSEIITFAESGTARKTLHFEISKEGSDLSVV
ERAEVWLFLKVPKANRTRTKVTIRLFQQQKHPQGSLDTGEEAEEVGLKGERSELLLSEKVVDARKSTWHVFPVSS
SIQRLLDQGKSSLDVRIACEQCQESGASLVLLGKKKKKEEEGEGKKKGGGEGGAGADEEKEQSHRPFLMLQARQS
EDHPHRRRRRGLECDGKVNICCKKQFFVSFKDIGWNDWIIAPSGYHANYCEGECPSHIAGTSGSSLSFHSTVINH
YRMRGHSPFANLKSCCVPTKLRPMSMLYYDDGQNIIKKDIQNMIVEECGCS

Structural information

Interpro:	IPR029034 IPR000491 IPR001839 IPR001111 IPR015615 IPR017948
Prosite:	PS00250 PS51362
Pfam:	PF00019 PF00688
PDB:	1NYS 1NYU 1S4Y 2ARP 2ARV 2B0U 2P6A 3B4V 4MID 5HLY 5HLZ
PDBsum:	1NYS 1NYU 1S4Y 2ARP 2ARV 2B0U 2P6A 3B4V 4MID 5HLY 5HLZ
DIP:	5824
MINT:	1786936
STRING:	ENSP00000242208;

Other Databases

GeneCards: INHBA; Malacards: INHBA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0001541	ovarian follicle developm ent	IGI	biological_process
GO:0001541	ovarian follicle developm ent	NAS	biological_process
GO:0001942	hair follicle development	IGI	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IBA	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007399	nervous system developmen t	NAS	biological_process
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008584	male gonad development	IGI	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0017046	peptide hormone binding	IPI	molecular_function
GO:0021773	striatal medium spiny neu ron differentiation	IDA	biological_process
GO:0030154	cell differentiation	TAS	biological_process
GO:0030218	erythrocyte differentiati on	NAS	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032924	activin receptor signalin g pathway	IDA	biological_process
GO:0034711	inhibin binding	IEA	molecular_function
GO:0035987	endodermal cell different iation	IDA	biological_process
GO:0040007	growth	IEA	biological_process
GO:0042326	negative regulation of ph osphorylation	TAS	biological_process
GO:0042476	odontogenesis	IGI	biological_process
GO:0042493	response to drug	IDA	biological_process
GO:0042541	hemoglobin biosynthetic p rocess	IDA	biological_process
GO:0042701	progesterone secretion	IGI	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043408	regulation of MAPK cascad e	IBA	biological_process
GO:0043509	activin A complex	IDA	cellular_component
GO:0043512	inhibin A complex	IDA	cellular_component
GO:0045077	negative regulation of in terferon-gamma biosynthet ic process	TAS	biological_process
GO:0045578	negative regulation of B cell differentiation	TAS	biological_process
GO:0045648	positive regulation of er ythrocyte differentiation	IDA	biological_process
GO:0045650	negative regulation of ma crophage differentiation	TAS	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046880	regulation of follicle-st imulating hormone secreti on	IGI	biological_process
GO:0046881	positive regulation of fo llicle-stimulating hormon e secretion	TAS	biological_process
GO:0046882	negative regulation of fo llicle-stimulating hormon e secretion	NAS	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048333	mesodermal cell different iation	IEA	biological_process
GO:0048468	cell development	IBA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0060021	palate development	IGI	biological_process
GO:0060279	positive regulation of ov ulation	ISS	biological_process
GO:0060395	SMAD protein signal trans duction	IBA	biological_process
GO:0061029	eyelid development in cam era-type eye	ISS	biological_process
GO:0070699	type II activin receptor binding	IPI	molecular_function
GO:0071372	cellular response to foll icle-stimulating hormone stimulus	IEA	biological_process
GO:0071397	cellular response to chol esterol	IEA	biological_process
GO:0097154	GABAergic neuron differen tiation	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:2001241	positive regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IDA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0001541	ovarian follicle developm ent	IGI	biological_process
GO:0001541	ovarian follicle developm ent	NAS	biological_process
GO:0001707	mesoderm formation	IEA	biological_process
GO:0001942	hair follicle development	IGI	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IEA	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological_process
GO:0005102	receptor binding	IEA	molecular_function
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IBA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	IEA	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IEA	cellular_component
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005615	extracellular space	IEA	cellular_component
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007399	nervous system developmen t	NAS	biological_process
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	IEA	molecular_function
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008584	male gonad development	IGI	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0017046	peptide hormone binding	IPI	molecular_function
GO:0021773	striatal medium spiny neu ron differentiation	IDA	biological_process
GO:0030154	cell differentiation	TAS	biological_process
GO:0030218	erythrocyte differentiati on	NAS	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032924	activin receptor signalin g pathway	IDA	biological_process
GO:0034711	inhibin binding	IEA	molecular_function
GO:0035987	endodermal cell different iation	IDA	biological_process
GO:0040007	growth	IEA	biological_process
GO:0042326	negative regulation of ph osphorylation	TAS	biological_process
GO:0042476	odontogenesis	IGI	biological_process
GO:0042493	response to drug	IDA	biological_process
GO:0042541	hemoglobin biosynthetic p rocess	IDA	biological_process
GO:0042701	progesterone secretion	IGI	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043408	regulation of MAPK cascad e	IBA	biological_process
GO:0043509	activin A complex	IDA	cellular_component
GO:0043512	inhibin A complex	IEA	cellular_component
GO:0043512	inhibin A complex	IDA	cellular_component
GO:0045077	negative regulation of in terferon-gamma biosynthet ic process	TAS	biological_process
GO:0045578	negative regulation of B cell differentiation	TAS	biological_process
GO:0045648	positive regulation of er ythrocyte differentiation	IDA	biological_process
GO:0045650	negative regulation of ma crophage differentiation	TAS	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IEA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IEA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046880	regulation of follicle-st imulating hormone secreti on	IGI	biological_process
GO:0046881	positive regulation of fo llicle-stimulating hormon e secretion	TAS	biological_process
GO:0046882	negative regulation of fo llicle-stimulating hormon e secretion	NAS	biological_process
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0048333	mesodermal cell different iation	IEA	biological_process
GO:0048468	cell development	IBA	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0060021	palate development	IGI	biological_process
GO:0060279	positive regulation of ov ulation	IEA	biological_process
GO:0060279	positive regulation of ov ulation	ISS	biological_process
GO:0060395	SMAD protein signal trans duction	IBA	biological_process
GO:0061029	eyelid development in cam era-type eye	IEA	biological_process
GO:0061029	eyelid development in cam era-type eye	ISS	biological_process
GO:0070699	type II activin receptor binding	IPI	molecular_function
GO:0071372	cellular response to foll icle-stimulating hormone stimulus	IEA	biological_process
GO:0071397	cellular response to chol esterol	IEA	biological_process
GO:0097154	GABAergic neuron differen tiation	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:2001241	positive regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IDA	biological_process
GO:0000082	G1/S transition of mitoti c cell cycle	IDA	biological_process
GO:0001541	ovarian follicle developm ent	IGI	biological_process
GO:0001541	ovarian follicle developm ent	NAS	biological_process
GO:0001942	hair follicle development	IGI	biological_process
GO:0002244	hematopoietic progenitor cell differentiation	IDA	biological_process
GO:0005125	cytokine activity	IDA	molecular_function
GO:0005160	transforming growth facto r beta receptor binding	IBA	molecular_function
GO:0005179	hormone activity	TAS	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005576	extracellular region	IDA	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0005576	extracellular region	TAS	cellular_component
GO:0006357	regulation of transcripti on from RNA polymerase II promoter	IDA	biological_process
GO:0006952	defense response	TAS	biological_process
GO:0007050	cell cycle arrest	IDA	biological_process
GO:0007166	cell surface receptor sig naling pathway	TAS	biological_process
GO:0007267	cell-cell signaling	TAS	biological_process
GO:0007399	nervous system developmen t	NAS	biological_process
GO:0008083	growth factor activity	TAS	molecular_function
GO:0008285	negative regulation of ce ll proliferation	IDA	biological_process
GO:0008584	male gonad development	IGI	biological_process
GO:0010628	positive regulation of ge ne expression	IDA	biological_process
GO:0010862	positive regulation of pa thway-restricted SMAD pro tein phosphorylation	IDA	biological_process
GO:0017046	peptide hormone binding	IPI	molecular_function
GO:0021773	striatal medium spiny neu ron differentiation	IDA	biological_process
GO:0030154	cell differentiation	TAS	biological_process
GO:0030218	erythrocyte differentiati on	NAS	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0030308	negative regulation of ce ll growth	IDA	biological_process
GO:0032270	positive regulation of ce llular protein metabolic process	IDA	biological_process
GO:0032924	activin receptor signalin g pathway	IDA	biological_process
GO:0035987	endodermal cell different iation	IDA	biological_process
GO:0042326	negative regulation of ph osphorylation	TAS	biological_process
GO:0042476	odontogenesis	IGI	biological_process
GO:0042493	response to drug	IDA	biological_process
GO:0042541	hemoglobin biosynthetic p rocess	IDA	biological_process
GO:0042701	progesterone secretion	IGI	biological_process
GO:0042802	identical protein binding	IPI	molecular_function
GO:0043408	regulation of MAPK cascad e	IBA	biological_process
GO:0043509	activin A complex	IDA	cellular_component
GO:0043512	inhibin A complex	IDA	cellular_component
GO:0045077	negative regulation of in terferon-gamma biosynthet ic process	TAS	biological_process
GO:0045578	negative regulation of B cell differentiation	TAS	biological_process
GO:0045648	positive regulation of er ythrocyte differentiation	IDA	biological_process
GO:0045650	negative regulation of ma crophage differentiation	TAS	biological_process
GO:0045786	negative regulation of ce ll cycle	IDA	biological_process
GO:0045893	positive regulation of tr anscription, DNA-template d	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IDA	biological_process
GO:0046880	regulation of follicle-st imulating hormone secreti on	IGI	biological_process
GO:0046881	positive regulation of fo llicle-stimulating hormon e secretion	TAS	biological_process
GO:0046882	negative regulation of fo llicle-stimulating hormon e secretion	NAS	biological_process
GO:0048468	cell development	IBA	biological_process
GO:0060021	palate development	IGI	biological_process
GO:0060279	positive regulation of ov ulation	ISS	biological_process
GO:0060395	SMAD protein signal trans duction	IBA	biological_process
GO:0061029	eyelid development in cam era-type eye	ISS	biological_process
GO:0070699	type II activin receptor binding	IPI	molecular_function
GO:0097154	GABAergic neuron differen tiation	IDA	biological_process
GO:0097191	extrinsic apoptotic signa ling pathway	IDA	biological_process
GO:2001241	positive regulation of ex trinsic apoptotic signali ng pathway in absence of ligand	IDA	biological_process

KEGG pathways

hsa04060  Cytokine-cytokine receptor interaction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04350  TGF-beta signaling pathway

Diseases

Associated diseases	References
Amenorrhea	PMID: 21627557
Amyotrophic lateral sclerosis (ALS)	PMID: 18608101
Asthenozoospermia	PMID: 25269872
Azoospermia	PMID: 9619549
Benign ovarian cysts	PMID: 15893868
Congenital hypogonadotropic hypogonadism	PMID: 20980953
Cryptorchidism	PMID: 11397857
Decreased ovarian reserve (DOR)	PMID: 25176102
Disorders of spermatogenesis	PMID: 17462637
Endometriosis	PMID: 10899494
Female infertility	PMID: 11706635
Gonadal dysfunction	PMID: 10927037
Hypogonadotropic hypogonadism	PMID: 20826577
Hypospermatogenesis	PMID: 24752115
Hypothalamic amenorrhea	PMID: 9806574
Impaired spermatogenesis	PMID: 21104644
Implantation failure	PMID: 20457668
Luteal phase defects (LPD)	PMID: 2506214
Male gonadal dysfunction	PMID: 12466353
Male infertility	PMID: 14574812
Mayer-Rokitansky-Kuster-Hauser syndrome	PMID: 19101883
Non-obstructive azoospermia (NOA)	PMID: 20172518
Oligoazoospermia	PMID: 12554256
Oligozoospermia	PMID: 25740852
Oocyte retrieval	PMID: 16650414
Ovarian endometriosis	PMID: 11172841
Ovarian endometriosis	PMID: 19386982
Ovarian reserve	PMID: 16277899
Ovarian hyperstimulation syndrome(OHSS)	PMID: 24455972
Polycystic ovary syndrome (PCOS)	PMID: 11278215
Ovarian endometriosis	INFBASE19386982
Ovarian endometriosis	INFBASE11172841
Female infertility	INFBASE10899494
Endometriosis associated infertility	INFBASE9806293
Endometriosis	INFBASE9806293
Poor ovarian response (POR)	PMID: 21843890
Premature ovarian failure ( POF)	PMID: 15562017
Primary ovarian insufficiency (POI)	PMID: 18211971
Psychiatric disorders	PMID: 19086053
Secondary amenorrhea	PMID: 9806574
Secondary oligoamenorrhea	PMID: 21737073
Sertoli cell-only syndrome (SCOS)	PMID: 15551748
Spermatogenetic defects	PMID: 11397833
Testicular spermatogenesis	PMID: 18154424
Tubal damage	PMID: 10735596
Unexplained infertility	PMID: 10783349
Varicocele	PMID: 12653784

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
10899494	Endometrio sis	30 (20 women wi th endometriosi s, 10 with tuba l factor)	Female infertility		Show abstract
19386982	Endometrio sis (ovari an)	30 (15 women wi th ovarian endo metrioma, 15 eu topic endometri um of healthy p articipants)		Activin A ActRII nodal cripto	Show abstract
9806293	Endometrio sis	72 (35 control women, 37 women with endometri osis)	Female infertility	activinA	Show abstract
11172841	Endometrio sis (ovari an)	19 women with o varian endometr iotic cysts		inhibin A activin A	Show abstract
21496809	Endometrio sis	96 (48 women wi th endometrioma , 48 women with out endometrios is)		activin A cripto follistatin	Show abstract