Endometriosis Knowledgebase

Search Result

Gene id

3655

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ITGA6 Gene UCSC Ensembl

Aliases

CD49f, ITGA6B, VLA-6

Gene name

integrin subunit alpha 6

Alternate names

integrin alpha-6, CD49 antigen-like family member F, integrin alpha6B, integrin, alpha 6,

Gene location

2q31.1 (172427353: 172506454) Exons: 28 NC_000002.12

Gene summary(Entrez)

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

OMIM

147556

Protein Summary

Protein general information

P23229

Name: Integrin alpha 6 (CD49 antigen like family member F) (VLA 6) (CD antigen CD49f) [Cleaved into: Integrin alpha 6 heavy chain; Integrin alpha 6 light chain; Processed integrin alpha 6 (Alpha6p)]

Length: 1130 Mass: 126,606

Tissue specificity: Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoforms containing segment X1 are ubiquitously expressed. Isoforms containing segment X1X2 are expressed in heart, kidney, placenta, colon, duodenum, myoblasts and myotu

Sequence

MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQ
RANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDI
FGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNT
FFDMNIFEDGPYEVGGETEHDESLVPVPANSYLGLLFLTSVSYTDPDQFVYKTRPPREQPDTFPDVMMNSYLGFS
LDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIG
APQYFDRDGEVGGAVYVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYH
GSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQK
TACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKV
CMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNL
KLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYS
AYRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPIT
AKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLTNLGTATLNIQWPKEISN
GKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVN
IRCPLRGLDSKASLILRSRLWNSTFLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYS
GVPWWIILVAILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQWITKWNE
NESYS

Structural information

Motifs	GFFKR motif.(1079-1083)
Interpro:	IPR013517 IPR013519 IPR000413 IPR013649 IPR018184 IPR032695
Prosite:	PS51470 PS00242
Pfam:	PF01839 PF08441
MINT:	5002506
STRING:	ENSP00000386896;

Other Databases

GeneCards: ITGA6; Malacards: ITGA6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005178	integrin binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005604	basement membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007044	cell-substrate junction a ssembly	TAS	biological_process
GO:0007160	cell-matrix adhesion	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0008305	integrin complex	IEA	cellular_component
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009925	basal plasma membrane	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010668	ectodermal cell different iation	IEP	biological_process
GO:0022409	positive regulation of ce ll-cell adhesion	IEA	biological_process
GO:0030056	hemidesmosome	IEA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031581	hemidesmosome assembly	TAS	biological_process
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0031668	cellular response to extr acellular stimulus	IEA	biological_process
GO:0033627	cell adhesion mediated by integrin	IEA	biological_process
GO:0035878	nail development	IMP	biological_process
GO:0042327	positive regulation of ph osphorylation	IMP	biological_process
GO:0043065	positive regulation of ap optotic process	IGI	biological_process
GO:0043547	positive regulation of GT Pase activity	IMP	biological_process
GO:0043588	skin development	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046847	filopodium assembly	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048565	digestive tract developme nt	IMP	biological_process
GO:0050873	brown fat cell differenti ation	IEA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0072001	renal system development	IMP	biological_process
GO:0097186	amelogenesis	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0038132	neuregulin binding	IDA	molecular_function
GO:0005178	integrin binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005604	basement membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007044	cell-substrate junction a ssembly	TAS	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007160	cell-matrix adhesion	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0008305	integrin complex	IEA	cellular_component
GO:0008305	integrin complex	IEA	cellular_component
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009925	basal plasma membrane	IEA	cellular_component
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010668	ectodermal cell different iation	IEP	biological_process
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016323	basolateral plasma membra ne	IEA	cellular_component
GO:0022409	positive regulation of ce ll-cell adhesion	IEA	biological_process
GO:0030056	hemidesmosome	IEA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031581	hemidesmosome assembly	TAS	biological_process
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0031668	cellular response to extr acellular stimulus	IEA	biological_process
GO:0033627	cell adhesion mediated by integrin	IEA	biological_process
GO:0035878	nail development	IMP	biological_process
GO:0042327	positive regulation of ph osphorylation	IMP	biological_process
GO:0042475	odontogenesis of dentin-c ontaining tooth	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IGI	biological_process
GO:0043547	positive regulation of GT Pase activity	IMP	biological_process
GO:0043588	skin development	IMP	biological_process
GO:0045178	basal part of cell	IEA	cellular_component
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0046847	filopodium assembly	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048565	digestive tract developme nt	IMP	biological_process
GO:0050873	brown fat cell differenti ation	IEA	biological_process
GO:0050900	leukocyte migration	IEA	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0072001	renal system development	IMP	biological_process
GO:0097186	amelogenesis	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0038132	neuregulin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007044	cell-substrate junction a ssembly	TAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010668	ectodermal cell different iation	IEP	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031581	hemidesmosome assembly	TAS	biological_process
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0035878	nail development	IMP	biological_process
GO:0042327	positive regulation of ph osphorylation	IMP	biological_process
GO:0043065	positive regulation of ap optotic process	IGI	biological_process
GO:0043547	positive regulation of GT Pase activity	IMP	biological_process
GO:0043588	skin development	IMP	biological_process
GO:0045944	positive regulation of tr anscription from RNA poly merase II promoter	IMP	biological_process
GO:0048565	digestive tract developme nt	IMP	biological_process
GO:0050900	leukocyte migration	TAS	biological_process
GO:0072001	renal system development	IMP	biological_process
GO:0097186	amelogenesis	IMP	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0038132	neuregulin binding	IDA	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa05145  Toxoplasmosis
hsa04810  Regulation of actin cytoskeleton
hsa04514  Cell adhesion molecules
hsa04640  Hematopoietic cell lineage
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy
hsa04512  ECM-receptor interaction
hsa05414  Dilated cardiomyopathy
hsa05412  Arrhythmogenic right ventricular cardiomyopathy

Diseases

Associated diseases	References
Azoospermia	PMID: 20590666
Cancer	PMID: 19767753
Uterine receptivity defects	PMID: 10519628
Cutis laxa	KEGG: H00557
Endometriosis	PMID: 8976878
Epidermolysis bullosa	OMIM: 147556
Oocyte maturity and follicular steroidogenesis	PMID: 15526973
Endometriosis	INFBASE8976878
Recurrent miscarriage	PMID: 14666169

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
8976878	Endometrio sis					Integrin alpha 3 integrin alpha 6	Show abstract