Endometriosis Knowledgebase

Search Result

Gene id

3669

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ISG20 Gene UCSC Ensembl

Aliases

CD25, HEM45

Gene name

interferon stimulated exonuclease gene 20

Alternate names

interferon-stimulated gene 20 kDa protein, estrogen-regulated transcript 45 protein, interferon stimulated exonuclease gene 20kDa, promyelocytic leukemia nuclear body-associated protein ISG20,

Gene location

15q26.1 (88635613: 88656343) Exons: 8 NC_000015.10

OMIM

604533

Protein Summary

Protein general information

Q96AZ6

Name: Interferon stimulated gene 20 kDa protein (EC 3.1.13.1) (Estrogen regulated transcript 45 protein) (Promyelocytic leukemia nuclear body associated protein ISG20)

Length: 181 Mass: 20,363

Tissue specificity: Highly expressed in peripheral blood leukocytes, spleen, thymus, colon and lung. Up regulated by E2 in estrogen receptor-positive breast cancer lines. {ECO

Sequence

MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARL
EILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHCRRVSLRVLSERLLHKSIQNSLLGHS
SVEDARATMELYQISQRIRARRGLPRLAVSD

Structural information

Interpro:	IPR013520 IPR012337
Pfam:	PF00929
PDB:	1WLJ
PDBsum:	1WLJ
MINT:	4714850
STRING:	ENSP00000306565;

Other Databases

GeneCards: ISG20; Malacards: ISG20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000175	3'-5'-exoribonuclease act ivity	IDA	molecular_function
GO:0000738	DNA catabolic process, ex onucleolytic	IDA	biological_process
GO:0004527	exonuclease activity	IMP	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006364	rRNA processing	IEA	biological_process
GO:0006401	RNA catabolic process	IDA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008310	single-stranded DNA 3'-5' exodeoxyribonuclease act ivity	IDA	molecular_function
GO:0008859	exoribonuclease II activi ty	IEA	molecular_function
GO:0009615	response to virus	IDA	biological_process
GO:0015030	Cajal body	IDA	cellular_component
GO:0016605	PML body	IDA	cellular_component
GO:0030619	U1 snRNA binding	IDA	molecular_function
GO:0030620	U2 snRNA binding	IDA	molecular_function
GO:0034511	U3 snoRNA binding	IDA	molecular_function
GO:0045071	negative regulation of vi ral genome replication	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051607	defense response to virus	IMP	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0090503	RNA phosphodiester bond h ydrolysis, exonucleolytic	IEA	biological_process
GO:0000175	3'-5'-exoribonuclease act ivity	IDA	molecular_function
GO:0000738	DNA catabolic process, ex onucleolytic	IDA	biological_process
GO:0002376	immune system process	IEA	biological_process
GO:0003676	nucleic acid binding	IEA	molecular_function
GO:0003723	RNA binding	IEA	molecular_function
GO:0004518	nuclease activity	IEA	molecular_function
GO:0004527	exonuclease activity	IEA	molecular_function
GO:0004527	exonuclease activity	IMP	molecular_function
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IEA	cellular_component
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IEA	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006364	rRNA processing	IEA	biological_process
GO:0006401	RNA catabolic process	IDA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008310	single-stranded DNA 3'-5' exodeoxyribonuclease act ivity	IDA	molecular_function
GO:0008859	exoribonuclease II activi ty	IEA	molecular_function
GO:0009615	response to virus	IDA	biological_process
GO:0015030	Cajal body	IEA	cellular_component
GO:0015030	Cajal body	IDA	cellular_component
GO:0016605	PML body	IDA	cellular_component
GO:0016787	hydrolase activity	IEA	molecular_function
GO:0030619	U1 snRNA binding	IDA	molecular_function
GO:0030620	U2 snRNA binding	IDA	molecular_function
GO:0034511	U3 snoRNA binding	IDA	molecular_function
GO:0045071	negative regulation of vi ral genome replication	IMP	biological_process
GO:0045087	innate immune response	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0051607	defense response to virus	IEA	biological_process
GO:0051607	defense response to virus	IMP	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process
GO:0090503	RNA phosphodiester bond h ydrolysis, exonucleolytic	IEA	biological_process
GO:0000175	3'-5'-exoribonuclease act ivity	IDA	molecular_function
GO:0000738	DNA catabolic process, ex onucleolytic	IDA	biological_process
GO:0004527	exonuclease activity	IMP	molecular_function
GO:0005634	nucleus	IDA	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005654	nucleoplasm	TAS	cellular_component
GO:0005730	nucleolus	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0006401	RNA catabolic process	IDA	biological_process
GO:0008283	cell proliferation	TAS	biological_process
GO:0008310	single-stranded DNA 3'-5' exodeoxyribonuclease act ivity	IDA	molecular_function
GO:0009615	response to virus	IDA	biological_process
GO:0015030	Cajal body	IDA	cellular_component
GO:0016605	PML body	IDA	cellular_component
GO:0030619	U1 snRNA binding	IDA	molecular_function
GO:0030620	U2 snRNA binding	IDA	molecular_function
GO:0034511	U3 snoRNA binding	IDA	molecular_function
GO:0045071	negative regulation of vi ral genome replication	IMP	biological_process
GO:0051607	defense response to virus	IMP	biological_process
GO:0060337	type I interferon signali ng pathway	TAS	biological_process

Diseases

Associated diseases	References
Endometriosis	PMID: 21156832
Endometriosis	INFBASE21156832

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
21156832	Endometrio sis			18 (9 endometri osis patients, 9 control women )		ISG20	Show abstract