Endometriosis Knowledgebase

Search Result

Gene id

3685

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ITGAV Gene UCSC Ensembl

Aliases

CD51, MSK8, VNRA, VTNR

Gene name

integrin subunit alpha V

Alternate names

integrin alpha-V, antigen identified by monoclonal antibody L230, integrin alphaVbeta3, integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51), vitronectin receptor subunit alpha,

Gene location

2q32.1 (186590062: 186680901) Exons: 31 NC_000002.12

Gene summary(Entrez)

The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015]

OMIM

193210

Protein Summary

Protein general information

P06756

Name: Integrin alpha V (Vitronectin receptor subunit alpha) (CD antigen CD51) [Cleaved into: Integrin alpha V heavy chain; Integrin alpha V light chain]

Length: 1048 Mass: 116,038

Sequence

MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGAPKANT
TQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQ
EREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKY
DPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNGFEVFARFGSAIA
PLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGQWAARSMPPSFGYSMKGATDIDKNGYP
DLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQV
ELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIV
SIPLQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSS
NLFDKVSPVVSHKVDLAVLAAVEIRGVSSPDHVFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAML
HLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNST
LVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

Structural information

Motifs	GFFKR motif.(1019-1023)
Interpro:	IPR013517 IPR013519 IPR000413 IPR013649 IPR018184 IPR032695
Prosite:	PS51470 PS00242
Pfam:	PF01839 PF00357 PF08441
PDB:	1JV2 1L5G 1M1X 1U8C 3IJE 4G1E 4G1M 4MMX 4MMY 4MMZ 4O02 4UM8 4UM9 5FFG 5FFO
PDBsum:	1JV2 1L5G 1M1X 1U8C 3IJE 4G1E 4G1M 4MMX 4MMY 4MMZ 4O02 4UM8 4UM9 5FFG 5FFO
DIP:	31785
MINT:	209462
STRING:	ENSP00000261023;

Other Databases

GeneCards: ITGAV; Malacards: ITGAV

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001525	angiogenesis	IEP	biological_process
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001968	fibronectin binding	IDA	molecular_function
GO:0002020	protease binding	IDA	molecular_function
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0005245	voltage-gated calcium cha nnel activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0007160	cell-matrix adhesion	NAS	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	NAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008305	integrin complex	NAS	cellular_component
GO:0008305	integrin complex	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	ISS	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IMP	biological_process
GO:0010888	negative regulation of li pid storage	IMP	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	ISS	cellular_component
GO:0016049	cell growth	IMP	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0031258	lamellipodium membrane	IDA	cellular_component
GO:0031527	filopodium membrane	IDA	cellular_component
GO:0031528	microvillus membrane	IDA	cellular_component
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0032369	negative regulation of li pid transport	IMP	biological_process
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0033690	positive regulation of os teoblast proliferation	IEA	biological_process
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034684	integrin alphav-beta5 com plex	IDA	cellular_component
GO:0034686	integrin alphav-beta8 com plex	IDA	cellular_component
GO:0034686	integrin alphav-beta8 com plex	IDA	cellular_component
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0035987	endodermal cell different iation	IMP	biological_process
GO:0038027	apolipoprotein A-I-mediat ed signaling pathway	IMP	biological_process
GO:0043277	apoptotic cell clearance	IEA	biological_process
GO:0045335	phagocytic vesicle	TAS	cellular_component
GO:0045715	negative regulation of lo w-density lipoprotein par ticle receptor biosynthet ic process	IMP	biological_process
GO:0045785	positive regulation of ce ll adhesion	IDA	biological_process
GO:0046718	viral entry into host cel l	TAS	biological_process
GO:0046718	viral entry into host cel l	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050431	transforming growth facto r beta binding	ISS	molecular_function
GO:0050748	negative regulation of li poprotein metabolic proce ss	IMP	biological_process
GO:0050764	regulation of phagocytosi s	IDA	biological_process
GO:0050840	extracellular matrix bind ing	IDA	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050919	negative chemotaxis	IMP	biological_process
GO:0052066	entry of symbiont into ho st cell by promotion of h ost phagocytosis	NAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070371	ERK1 and ERK2 cascade	ISS	biological_process
GO:0070588	calcium ion transmembrane transport	IDA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	ISS	biological_process
GO:1990430	extracellular matrix prot ein binding	IDA	molecular_function
GO:2000425	regulation of apoptotic c ell clearance	ISS	biological_process
GO:2000536	negative regulation of en try of bacterium into hos t cell	IDA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0001846	opsonin binding	ISS	molecular_function
GO:0005080	protein kinase C binding	ISS	molecular_function
GO:0017134	fibroblast growth factor binding	IDA	molecular_function
GO:0019960	C-X3-C chemokine binding	IDA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0038132	neuregulin binding	IDA	molecular_function
GO:0001525	angiogenesis	IEP	biological_process
GO:0001568	blood vessel development	IEA	biological_process
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001846	opsonin binding	IEA	molecular_function
GO:0001968	fibronectin binding	IDA	molecular_function
GO:0002020	protease binding	IDA	molecular_function
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0005080	protein kinase C binding	IEA	molecular_function
GO:0005245	voltage-gated calcium cha nnel activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005622	intracellular	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IDA	biological_process
GO:0007160	cell-matrix adhesion	NAS	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	NAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008305	integrin complex	IEA	cellular_component
GO:0008305	integrin complex	NAS	cellular_component
GO:0008305	integrin complex	IDA	cellular_component
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	ISS	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IMP	biological_process
GO:0010888	negative regulation of li pid storage	IMP	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	ISS	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016049	cell growth	IMP	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0031258	lamellipodium membrane	IDA	cellular_component
GO:0031527	filopodium membrane	IDA	cellular_component
GO:0031528	microvillus membrane	IDA	cellular_component
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0032369	negative regulation of li pid transport	IMP	biological_process
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0033690	positive regulation of os teoblast proliferation	IEA	biological_process
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034684	integrin alphav-beta5 com plex	IDA	cellular_component
GO:0034686	integrin alphav-beta8 com plex	IDA	cellular_component
GO:0034686	integrin alphav-beta8 com plex	IDA	cellular_component
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0035987	endodermal cell different iation	IMP	biological_process
GO:0038027	apolipoprotein A-I-mediat ed signaling pathway	IMP	biological_process
GO:0043277	apoptotic cell clearance	IEA	biological_process
GO:0045335	phagocytic vesicle	TAS	cellular_component
GO:0045715	negative regulation of lo w-density lipoprotein par ticle receptor biosynthet ic process	IMP	biological_process
GO:0045785	positive regulation of ce ll adhesion	IDA	biological_process
GO:0046718	viral entry into host cel l	TAS	biological_process
GO:0046718	viral entry into host cel l	IMP	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050431	transforming growth facto r beta binding	ISS	molecular_function
GO:0050748	negative regulation of li poprotein metabolic proce ss	IMP	biological_process
GO:0050764	regulation of phagocytosi s	IDA	biological_process
GO:0050840	extracellular matrix bind ing	IDA	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050919	negative chemotaxis	IMP	biological_process
GO:0052066	entry of symbiont into ho st cell by promotion of h ost phagocytosis	NAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070371	ERK1 and ERK2 cascade	IEA	biological_process
GO:0070371	ERK1 and ERK2 cascade	ISS	biological_process
GO:0070588	calcium ion transmembrane transport	IDA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	IEA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	ISS	biological_process
GO:1990430	extracellular matrix prot ein binding	IDA	molecular_function
GO:2000425	regulation of apoptotic c ell clearance	IEA	biological_process
GO:2000425	regulation of apoptotic c ell clearance	ISS	biological_process
GO:2000536	negative regulation of en try of bacterium into hos t cell	IDA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0001846	opsonin binding	ISS	molecular_function
GO:0005080	protein kinase C binding	ISS	molecular_function
GO:0017134	fibroblast growth factor binding	IDA	molecular_function
GO:0019960	C-X3-C chemokine binding	IDA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0038132	neuregulin binding	IDA	molecular_function
GO:0001525	angiogenesis	IEP	biological_process
GO:0001968	fibronectin binding	IDA	molecular_function
GO:0002020	protease binding	IDA	molecular_function
GO:0002479	antigen processing and pr esentation of exogenous p eptide antigen via MHC cl ass I, TAP-dependent	TAS	biological_process
GO:0005245	voltage-gated calcium cha nnel activity	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005887	integral component of pla sma membrane	NAS	cellular_component
GO:0005887	integral component of pla sma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0007155	cell adhesion	IDA	biological_process
GO:0007160	cell-matrix adhesion	NAS	biological_process
GO:0007160	cell-matrix adhesion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	NAS	biological_process
GO:0008284	positive regulation of ce ll proliferation	IDA	biological_process
GO:0008305	integrin complex	NAS	cellular_component
GO:0008305	integrin complex	IDA	cellular_component
GO:0009986	cell surface	ISS	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010745	negative regulation of ma crophage derived foam cel l differentiation	IMP	biological_process
GO:0010888	negative regulation of li pid storage	IMP	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	ISS	cellular_component
GO:0016049	cell growth	IMP	biological_process
GO:0016477	cell migration	IMP	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031258	lamellipodium membrane	IDA	cellular_component
GO:0031527	filopodium membrane	IDA	cellular_component
GO:0031528	microvillus membrane	IDA	cellular_component
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0032369	negative regulation of li pid transport	IMP	biological_process
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034446	substrate adhesion-depend ent cell spreading	IDA	biological_process
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034683	integrin alphav-beta3 com plex	IDA	cellular_component
GO:0034684	integrin alphav-beta5 com plex	IDA	cellular_component
GO:0034686	integrin alphav-beta8 com plex	IDA	cellular_component
GO:0034686	integrin alphav-beta8 com plex	IDA	cellular_component
GO:0035867	alphav-beta3 integrin-IGF -1-IGF1R complex	IDA	cellular_component
GO:0035987	endodermal cell different iation	IMP	biological_process
GO:0038027	apolipoprotein A-I-mediat ed signaling pathway	IMP	biological_process
GO:0045335	phagocytic vesicle	TAS	cellular_component
GO:0045715	negative regulation of lo w-density lipoprotein par ticle receptor biosynthet ic process	IMP	biological_process
GO:0045785	positive regulation of ce ll adhesion	IDA	biological_process
GO:0046718	viral entry into host cel l	TAS	biological_process
GO:0046718	viral entry into host cel l	IMP	biological_process
GO:0048010	vascular endothelial grow th factor receptor signal ing pathway	TAS	biological_process
GO:0050431	transforming growth facto r beta binding	ISS	molecular_function
GO:0050748	negative regulation of li poprotein metabolic proce ss	IMP	biological_process
GO:0050764	regulation of phagocytosi s	IDA	biological_process
GO:0050840	extracellular matrix bind ing	IDA	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050919	negative chemotaxis	IMP	biological_process
GO:0052066	entry of symbiont into ho st cell by promotion of h ost phagocytosis	NAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070371	ERK1 and ERK2 cascade	ISS	biological_process
GO:0070588	calcium ion transmembrane transport	IDA	biological_process
GO:0097192	extrinsic apoptotic signa ling pathway in absence o f ligand	ISS	biological_process
GO:1990430	extracellular matrix prot ein binding	IDA	molecular_function
GO:2000425	regulation of apoptotic c ell clearance	ISS	biological_process
GO:2000536	negative regulation of en try of bacterium into hos t cell	IDA	biological_process
GO:2001237	negative regulation of ex trinsic apoptotic signali ng pathway	IMP	biological_process
GO:0001846	opsonin binding	ISS	molecular_function
GO:0005080	protein kinase C binding	ISS	molecular_function
GO:0017134	fibroblast growth factor binding	IDA	molecular_function
GO:0019960	C-X3-C chemokine binding	IDA	molecular_function
GO:0031994	insulin-like growth facto r I binding	IDA	molecular_function
GO:0038132	neuregulin binding	IDA	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa04510  Focal adhesion
PTHR23220:SF4  CCKR signaling map
hsa05418  Fluid shear stress and atherosclerosis
hsa04810  Regulation of actin cytoskeleton
hsa04514  Cell adhesion molecules
hsa04919  Thyroid hormone signaling pathway
hsa04145  Phagosome
hsa05222  Small cell lung cancer
hsa05410  Hypertrophic cardiomyopathy
hsa04512  ECM-receptor interaction
hsa05414  Dilated cardiomyopathy
PTHR23220:SF4  CCKR signaling map
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
PTHR23220:SF4  CCKR signaling map

Diseases

Associated diseases	References
Cancer	PMID: 18550570
Endometriosis	PMID: 22215628
Female infertility	PMID: 12202414
Female infertility	PMID: 16433835
Impaired endometrial receptivity	PMID: 21505981
Implantation failure	PMID: 20224109
Endometriosis associated infertility	INFBASE22215628
Female infertility	INFBASE12372469
Uterine receptivity	INFBASE7519194
Endometriosis	INFBASE7519194
Polycystic ovary syndrome (PCOS)	PMID: 18353318
Priapism	PMID: 17408468
Recurrent implantation failure (RIF)	PMID: 23755950
Recurrent miscarriage	PMID: 21109038
Rheumatoid arthritis	PMID: 17615072
Unexplained infertility	PMID: 24690239
Varicocele	PMID: 19062002

PubMed references

PMID	Condition	Population details	Infertility_type	Associated_genes	Abstract
22215628	Endometrio sis	60 (20 infertil e patients with Stage I or II endometriosis a s the only dete ctable cause of infertility, 2 0 infertile pat ients with unex plained inferti lity, 20 fertil e women undergo ing tubal steri lization)	Female infertility	OPN integrin	Show abstract
7519194	Endometrio sis	241 women whose biopsies were obtained after day 19, a lack of beta 3 expre ssion was found to be closely related to the diagnosis of en dometriosis		alpha v beta 3 vitronectin receptor integrin	Show abstract
17678915	Endometrio sis	35 (20 during l uteal phase, 15 during menustr ual phase were selected for th is study based on cycle phase and presence/ab sence of endome triosis )		alpha(V) integrin IL-1 beta MCP-1 RANTES VCAM-1	Show abstract
12372469	Endometrio sis	39 (9 fertile w omen with regul ar cycles, 30 i nfertile women with varying se verity of endom etriosis)	Female infertility	NOS alpha(v)beta(3) integrin	Show abstract
14714826	Endometrio sis	36 (12 infertil e patients with stage I or II endometriosis a s the only caus e of infertilit y, 12 infertile patients havin g unexplained i nfertility, and 12 fertile wom en who were und ergoing tubal s terilization)	Female infertility		Show abstract