Endometriosis Knowledgebase

Search Result

Gene id

3688

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ITGB1 Gene UCSC Ensembl

Aliases

CD29, FNRB, GPIIA, MDF2, MSK12, VLA-BETA, VLAB

Gene name

integrin subunit beta 1

Alternate names

integrin beta-1, glycoprotein IIa, integrin VLA-4 beta subunit, integrin beta 1, integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12), very late activation protein, beta polypeptide,

Gene location

10p11.22 (32958364: 32900317) Exons: 18 NC_000010.11

Gene summary(Entrez)

Integrins are heterodimeric proteins made up of alpha and beta subunits. At least 18 alpha and 8 beta subunits have been described in mammals. Integrin family members are membrane receptors involved in cell adhesion and recognition in a variety of processes including embryogenesis, hemostasis, tissue repair, immune response and metastatic diffusion of tumor cells. This gene encodes a beta subunit. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

OMIM

135630

Protein Summary

Protein general information

P05556

Name: Integrin beta 1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA 4 subunit beta) (CD antigen CD29)

Length: 798 Mass: 88,415

Tissue specificity: Isoform 1 is widely expressed, other isoforms are generally coexpressed with a more restricted distribution. Isoform 2 is expressed in skin, liver, skeletal muscle, cardiac muscle, placenta, umbilical vein endothelial cells, neuroblast

Sequence

MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGC
PPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMD
LSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSL
TNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAY
NSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGF
TEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEIC
SNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVES
RDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLI
WKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK

Structural information

Protein Domains	VWFA. (140-378)
Interpro:	IPR013111 IPR027071 IPR033760 IPR015812 IPR014836 IPR012896 IPR002369 IPR032695 IPR016201 IPR002035
Prosite:	PS00022 PS00243
Pfam:	PF07974 PF08725 PF07965 PF00362 PF17205
PDB:	1K11 1LHA 3G9W 3T9K 3VI3 3VI4 4DX9 4WJK 4WK0 4WK2 4WK4
PDBsum:	1K11 1LHA 3G9W 3T9K 3VI3 3VI4 4DX9 4WJK 4WK0 4WK2 4WK4
DIP:	312
MINT:	140089
STRING:	ENSP00000303351;

Other Databases

GeneCards: ITGB1; Malacards: ITGB1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000082	G1/S transition of mitoti c cell cycle	IEA	biological_process
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001669	acrosomal vesicle	IEA	cellular_component
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001708	cell fate specification	IEA	biological_process
GO:0001726	ruffle	TAS	cellular_component
GO:0001894	tissue homeostasis	IEA	biological_process
GO:0001948	glycoprotein binding	IEA	molecular_function
GO:0001968	fibronectin binding	IPI	molecular_function
GO:0002020	protease binding	IPI	molecular_function
GO:0002042	cell migration involved i n sprouting angiogenesis	IEA	biological_process
GO:0003779	actin binding	IDA	molecular_function
GO:0005178	integrin binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005604	basement membrane	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	NAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006874	cellular calcium ion home ostasis	IEA	biological_process
GO:0006968	cellular defense response	TAS	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	TAS	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007161	calcium-independent cell- matrix adhesion	IGI	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0008277	regulation of G-protein c oupled receptor protein s ignaling pathway	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008305	integrin complex	NAS	cellular_component
GO:0008354	germ cell migration	IEA	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010710	regulation of collagen ca tabolic process	IDA	biological_process
GO:0010811	positive regulation of ce ll-substrate adhesion	IEA	biological_process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological_process
GO:0014704	intercalated disc	IEA	cellular_component
GO:0014823	response to activity	IEA	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	IDA	cellular_component
GO:0016477	cell migration	TAS	biological_process
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0021943	formation of radial glial scaffolds	IEA	biological_process
GO:0030027	lamellipodium	IEA	cellular_component
GO:0030056	hemidesmosome	IEA	cellular_component
GO:0030175	filopodium	IDA	cellular_component
GO:0030183	B cell differentiation	IC	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0031345	negative regulation of ce ll projection organizatio n	IEA	biological_process
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0031594	neuromuscular junction	IDA	cellular_component
GO:0031623	receptor internalization	ISS	biological_process
GO:0032154	cleavage furrow	IEA	cellular_component
GO:0032403	protein complex binding	IPI	molecular_function
GO:0032587	ruffle membrane	NAS	cellular_component
GO:0032594	protein transport within lipid bilayer	IEA	biological_process
GO:0033631	cell-cell adhesion mediat ed by integrin	IEP	biological_process
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034665	integrin alpha1-beta1 com plex	IDA	cellular_component
GO:0034666	integrin alpha2-beta1 com plex	IDA	cellular_component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular_component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular_component
GO:0034677	integrin alpha7-beta1 com plex	IEA	cellular_component
GO:0034678	integrin alpha8-beta1 com plex	TAS	cellular_component
GO:0034679	integrin alpha9-beta1 com plex	IEA	cellular_component
GO:0034680	integrin alpha10-beta1 co mplex	IDA	cellular_component
GO:0034681	integrin alpha11-beta1 co mplex	IDA	cellular_component
GO:0034698	response to gonadotropin	IEA	biological_process
GO:0035024	negative regulation of Rh o protein signal transduc tion	IEA	biological_process
GO:0035748	myelin sheath abaxonal re gion	IEA	cellular_component
GO:0042277	peptide binding	IEA	molecular_function
GO:0042383	sarcolemma	IDA	cellular_component
GO:0042470	melanosome	IEA	cellular_component
GO:0042493	response to drug	IEA	biological_process
GO:0043065	positive regulation of ap optotic process	IGI	biological_process
GO:0043197	dendritic spine	IEA	cellular_component
GO:0043235	receptor complex	IDA	cellular_component
GO:0043236	laminin binding	IEA	molecular_function
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IMP	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0045214	sarcomere organization	IEA	biological_process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological_process
GO:0045807	positive regulation of en docytosis	IEA	biological_process
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0046982	protein heterodimerizatio n activity	NAS	molecular_function
GO:0048333	mesodermal cell different iation	IEP	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048675	axon extension	IEA	biological_process
GO:0048813	dendrite morphogenesis	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050901	leukocyte tethering or ro lling	IMP	biological_process
GO:0051393	alpha-actinin binding	IEA	molecular_function
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0055007	cardiac muscle cell diffe rentiation	IEA	biological_process
GO:0055037	recycling endosome	IEA	cellular_component
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070830	bicellular tight junction assembly	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071305	cellular response to vita min D	IEA	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:0071438	invadopodium membrane	IDA	cellular_component
GO:0071479	cellular response to ioni zing radiation	IEA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0097060	synaptic membrane	IEA	cellular_component
GO:0098639	collagen binding involved in cell-matrix adhesion	IMP	molecular_function
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0005925	focal adhesion	IDA	cellular_component
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0019960	C-X3-C chemokine binding	IDA	molecular_function
GO:0000082	G1/S transition of mitoti c cell cycle	IEA	biological_process
GO:0001618	virus receptor activity	IEA	molecular_function
GO:0001669	acrosomal vesicle	IEA	cellular_component
GO:0001701	in utero embryonic develo pment	IEA	biological_process
GO:0001708	cell fate specification	IEA	biological_process
GO:0001726	ruffle	IEA	cellular_component
GO:0001726	ruffle	TAS	cellular_component
GO:0001894	tissue homeostasis	IEA	biological_process
GO:0001948	glycoprotein binding	IEA	molecular_function
GO:0001968	fibronectin binding	IEA	molecular_function
GO:0001968	fibronectin binding	IPI	molecular_function
GO:0002020	protease binding	IEA	molecular_function
GO:0002020	protease binding	IPI	molecular_function
GO:0002042	cell migration involved i n sprouting angiogenesis	IEA	biological_process
GO:0003779	actin binding	IEA	molecular_function
GO:0003779	actin binding	IDA	molecular_function
GO:0004872	receptor activity	IEA	molecular_function
GO:0005102	receptor binding	IEA	molecular_function
GO:0005178	integrin binding	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005518	collagen binding	IEA	molecular_function
GO:0005604	basement membrane	IEA	cellular_component
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005768	endosome	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	NAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005911	cell-cell junction	IEA	cellular_component
GO:0005912	adherens junction	IEA	cellular_component
GO:0005925	focal adhesion	IEA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006874	cellular calcium ion home ostasis	IEA	biological_process
GO:0006968	cellular defense response	TAS	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	TAS	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IEA	biological_process
GO:0007160	cell-matrix adhesion	IEA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007161	calcium-independent cell- matrix adhesion	IGI	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0008277	regulation of G-protein c oupled receptor protein s ignaling pathway	IEA	biological_process
GO:0008284	positive regulation of ce ll proliferation	IEA	biological_process
GO:0008285	negative regulation of ce ll proliferation	IEA	biological_process
GO:0008305	integrin complex	IEA	cellular_component
GO:0008305	integrin complex	IEA	cellular_component
GO:0008305	integrin complex	NAS	cellular_component
GO:0008354	germ cell migration	IEA	biological_process
GO:0008542	visual learning	IEA	biological_process
GO:0009897	external side of plasma m embrane	IEA	cellular_component
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010710	regulation of collagen ca tabolic process	IDA	biological_process
GO:0010811	positive regulation of ce ll-substrate adhesion	IEA	biological_process
GO:0010976	positive regulation of ne uron projection developme nt	IEA	biological_process
GO:0014704	intercalated disc	IEA	cellular_component
GO:0014823	response to activity	IEA	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016032	viral process	IEA	biological_process
GO:0016477	cell migration	IEA	biological_process
GO:0016477	cell migration	TAS	biological_process
GO:0019900	kinase binding	IEA	molecular_function
GO:0019901	protein kinase binding	IEA	molecular_function
GO:0019904	protein domain specific b inding	IEA	molecular_function
GO:0021943	formation of radial glial scaffolds	IEA	biological_process
GO:0030027	lamellipodium	IEA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030054	cell junction	IEA	cellular_component
GO:0030056	hemidesmosome	IEA	cellular_component
GO:0030175	filopodium	IDA	cellular_component
GO:0030183	B cell differentiation	IC	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030335	positive regulation of ce ll migration	IEA	biological_process
GO:0031175	neuron projection develop ment	IEA	biological_process
GO:0031345	negative regulation of ce ll projection organizatio n	IEA	biological_process
GO:0031410	cytoplasmic vesicle	IEA	cellular_component
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0031594	neuromuscular junction	IEA	cellular_component
GO:0031594	neuromuscular junction	IDA	cellular_component
GO:0031623	receptor internalization	IEA	biological_process
GO:0031623	receptor internalization	ISS	biological_process
GO:0031667	response to nutrient leve ls	IEA	biological_process
GO:0032154	cleavage furrow	IEA	cellular_component
GO:0032403	protein complex binding	IEA	molecular_function
GO:0032403	protein complex binding	IPI	molecular_function
GO:0032587	ruffle membrane	IEA	cellular_component
GO:0032587	ruffle membrane	NAS	cellular_component
GO:0032594	protein transport within lipid bilayer	IEA	biological_process
GO:0033631	cell-cell adhesion mediat ed by integrin	IEP	biological_process
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034665	integrin alpha1-beta1 com plex	IDA	cellular_component
GO:0034666	integrin alpha2-beta1 com plex	IDA	cellular_component
GO:0034667	integrin alpha3-beta1 com plex	IEA	cellular_component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular_component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular_component
GO:0034677	integrin alpha7-beta1 com plex	IEA	cellular_component
GO:0034678	integrin alpha8-beta1 com plex	TAS	cellular_component
GO:0034679	integrin alpha9-beta1 com plex	IEA	cellular_component
GO:0034680	integrin alpha10-beta1 co mplex	IDA	cellular_component
GO:0034681	integrin alpha11-beta1 co mplex	IDA	cellular_component
GO:0034698	response to gonadotropin	IEA	biological_process
GO:0035024	negative regulation of Rh o protein signal transduc tion	IEA	biological_process
GO:0035748	myelin sheath abaxonal re gion	IEA	cellular_component
GO:0042277	peptide binding	IEA	molecular_function
GO:0042383	sarcolemma	IEA	cellular_component
GO:0042383	sarcolemma	IEA	cellular_component
GO:0042383	sarcolemma	IDA	cellular_component
GO:0042470	melanosome	IEA	cellular_component
GO:0042493	response to drug	IEA	biological_process
GO:0042995	cell projection	IEA	cellular_component
GO:0043065	positive regulation of ap optotic process	IGI	biological_process
GO:0043197	dendritic spine	IEA	cellular_component
GO:0043235	receptor complex	IDA	cellular_component
GO:0043236	laminin binding	IEA	molecular_function
GO:0043410	positive regulation of MA PK cascade	IEA	biological_process
GO:0043547	positive regulation of GT Pase activity	IMP	biological_process
GO:0045121	membrane raft	IEA	cellular_component
GO:0045121	membrane raft	IDA	cellular_component
GO:0045202	synapse	IEA	cellular_component
GO:0045214	sarcomere organization	IEA	biological_process
GO:0045596	negative regulation of ce ll differentiation	IEA	biological_process
GO:0045665	negative regulation of ne uron differentiation	IEA	biological_process
GO:0045666	positive regulation of ne uron differentiation	IEA	biological_process
GO:0045807	positive regulation of en docytosis	IEA	biological_process
GO:0046718	viral entry into host cel l	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0046982	protein heterodimerizatio n activity	NAS	molecular_function
GO:0048333	mesodermal cell different iation	IEP	biological_process
GO:0048471	perinuclear region of cyt oplasm	IEA	cellular_component
GO:0048675	axon extension	IEA	biological_process
GO:0048738	cardiac muscle tissue dev elopment	IEA	biological_process
GO:0048813	dendrite morphogenesis	IEA	biological_process
GO:0050731	positive regulation of pe ptidyl-tyrosine phosphory lation	IEA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050901	leukocyte tethering or ro lling	IMP	biological_process
GO:0051393	alpha-actinin binding	IEA	molecular_function
GO:0051726	regulation of cell cycle	IEA	biological_process
GO:0055007	cardiac muscle cell diffe rentiation	IEA	biological_process
GO:0055037	recycling endosome	IEA	cellular_component
GO:0060135	maternal process involved in female pregnancy	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070830	bicellular tight junction assembly	IEA	biological_process
GO:0071260	cellular response to mech anical stimulus	IEA	biological_process
GO:0071305	cellular response to vita min D	IEA	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	IEA	biological_process
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:0071438	invadopodium membrane	IEA	cellular_component
GO:0071438	invadopodium membrane	IDA	cellular_component
GO:0071479	cellular response to ioni zing radiation	IEA	biological_process
GO:0071559	response to transforming growth factor beta	IEA	biological_process
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0097060	synaptic membrane	IEA	cellular_component
GO:0098639	collagen binding involved in cell-matrix adhesion	IMP	molecular_function
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0005925	focal adhesion	IDA	cellular_component
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0019960	C-X3-C chemokine binding	IDA	molecular_function
GO:0001726	ruffle	TAS	cellular_component
GO:0001968	fibronectin binding	IPI	molecular_function
GO:0002020	protease binding	IPI	molecular_function
GO:0003779	actin binding	IDA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005737	cytoplasm	IDA	cellular_component
GO:0005886	plasma membrane	NAS	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	IDA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0005925	focal adhesion	IDA	cellular_component
GO:0006968	cellular defense response	TAS	biological_process
GO:0007156	homophilic cell adhesion via plasma membrane adhes ion molecules	TAS	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007161	calcium-independent cell- matrix adhesion	IGI	biological_process
GO:0007229	integrin-mediated signali ng pathway	IMP	biological_process
GO:0008305	integrin complex	NAS	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0010710	regulation of collagen ca tabolic process	IDA	biological_process
GO:0015026	coreceptor activity	TAS	molecular_function
GO:0016020	membrane	IDA	cellular_component
GO:0016477	cell migration	TAS	biological_process
GO:0030175	filopodium	IDA	cellular_component
GO:0030183	B cell differentiation	IC	biological_process
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0031589	cell-substrate adhesion	IMP	biological_process
GO:0031594	neuromuscular junction	IDA	cellular_component
GO:0031623	receptor internalization	ISS	biological_process
GO:0032403	protein complex binding	IPI	molecular_function
GO:0032587	ruffle membrane	NAS	cellular_component
GO:0033631	cell-cell adhesion mediat ed by integrin	IEP	biological_process
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034665	integrin alpha1-beta1 com plex	IDA	cellular_component
GO:0034666	integrin alpha2-beta1 com plex	IDA	cellular_component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular_component
GO:0034667	integrin alpha3-beta1 com plex	IDA	cellular_component
GO:0034678	integrin alpha8-beta1 com plex	TAS	cellular_component
GO:0034680	integrin alpha10-beta1 co mplex	IDA	cellular_component
GO:0034681	integrin alpha11-beta1 co mplex	IDA	cellular_component
GO:0042383	sarcolemma	IDA	cellular_component
GO:0043065	positive regulation of ap optotic process	IGI	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043547	positive regulation of GT Pase activity	IMP	biological_process
GO:0045121	membrane raft	IDA	cellular_component
GO:0046982	protein heterodimerizatio n activity	IDA	molecular_function
GO:0046982	protein heterodimerizatio n activity	NAS	molecular_function
GO:0048333	mesodermal cell different iation	IEP	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050839	cell adhesion molecule bi nding	IPI	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0050901	leukocyte tethering or ro lling	IMP	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:0071438	invadopodium membrane	IDA	cellular_component
GO:0090004	positive regulation of es tablishment of protein lo calization to plasma memb rane	IDA	biological_process
GO:0098639	collagen binding involved in cell-matrix adhesion	IMP	molecular_function
GO:2000811	negative regulation of an oikis	IMP	biological_process
GO:0007179	transforming growth facto r beta receptor signaling pathway	IMP	biological_process
GO:0043149	stress fiber assembly	IMP	biological_process
GO:0005925	focal adhesion	IDA	cellular_component
GO:0032587	ruffle membrane	IDA	cellular_component
GO:0019960	C-X3-C chemokine binding	IDA	molecular_function

KEGG pathways

hsa05200  Pathways in cancer
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa04015  Rap1 signaling pathway
hsa04510  Focal adhesion
hsa05145  Toxoplasmosis
hsa04810  Regulation of actin cytoskeleton
hsa04514  Cell adhesion molecules
hsa04145  Phagosome
hsa04360  Axon guidance
hsa05140  Leishmaniasis
hsa05222  Small cell lung cancer
hsa05133  Pertussis
hsa04670  Leukocyte transendothelial migration
hsa04611  Platelet activation
hsa04530  Tight junction
hsa05410  Hypertrophic cardiomyopathy
hsa04512  ECM-receptor interaction
hsa05414  Dilated cardiomyopathy
hsa05100  Bacterial invasion of epithelial cells
hsa05412  Arrhythmogenic right ventricular cardiomyopathy
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
PTHR10082:SF28  CCKR signaling map
PTHR10082:SF28  CCKR signaling map
PTHR10082:SF28  CCKR signaling map

Diseases

Associated diseases	References
Alzheimer's disease	PMID: 16385451
Cancer	PMID: 19064571
Depression	PMID: 20800221
Endometriosis	PMID: 26357653
Female infertility	PMID: 7691869
Implantation failure	PMID: 1378028
Male infertility	PMID: 12801565
Myocardial infarction	PMID: 11776052
Endometriosis	INFBASE26357653
Adenomyosis	INFBASE9392916
Recurrent miscarriage	PMID: 25218545

PubMed references

PMID	Condition	Population details	Associated_genes	Abstract
8595131	Endometrio sis		CD18 CD29	Show abstract
26357653	Endometrio sis		ITGB1 AMIGO2 VAV3 and PSEN2	Show abstract
9392916	Endometrio sis	46 (24 patients with endometri osis, 22 patien ts with adenomy osis)	VLA-2 VLA-3 VLA-4 VLA-5 VLA-6 E-cadherin	Show abstract