Endometriosis Knowledgebase

Search Result

Gene id

3689

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed references

Gene Summary

Gene Symbol

ITGB2 Gene UCSC Ensembl

Aliases

CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7

Gene name

integrin subunit beta 2

Alternate names

integrin beta-2, cell surface adhesion glycoprotein (LFA-1/CR3/P150,959 beta subunit precursor), complement component 3 receptor 3 and 4 subunit, complement receptor C3 beta-subunit, integrin beta chain, beta 2, integrin, beta 2 (complement component 3 recepto,

Gene location

21q22.3 (44928872: 44885948) Exons: 17 NC_000021.9

Gene summary(Entrez)

This gene encodes an integrin beta chain, which combines with multiple different alpha chains to form different integrin heterodimers. Integrins are integral cell-surface proteins that participate in cell adhesion as well as cell-surface mediated signalling. The encoded protein plays an important role in immune response and defects in this gene cause leukocyte adhesion deficiency. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

OMIM

600065

Protein Summary

Protein general information

P05107

Name: Integrin beta 2 (Cell surface adhesion glycoproteins LFA 1/CR3/p150,95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18)

Length: 769 Mass: 84,782

Tissue specificity: Leukocytes. {ECO

Sequence

MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAA
DDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLG
GDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQL
ISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALP
DTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCR
DQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVP
GKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYT
LEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNND
NPLFKSATTTVMNPKFAES

Structural information

Protein Domains	VWFA. (124-363)
Motifs	Cell attachment(397-399)
Interpro:	IPR033760 IPR015812 IPR015439 IPR014836 IPR012896 IPR002369 IPR032695 IPR016201 IPR002035
Prosite:	PS00022 PS01186 PS00243
Pfam:	PF08725 PF07965 PF00362 PF17205
PDB:	1JX3 1L3Y 1YUK 2JF1 2P26 2P28 2V7D 3K6S 3K71 3K72 4NEH 4NEN 5E6R 5E6S 5E6U 5E6V 5E6W 5E6X 5ES4
PDBsum:	1JX3 1L3Y 1YUK 2JF1 2P26 2P28 2V7D 3K6S 3K71 3K72 4NEH 4NEN 5E6R 5E6S 5E6U 5E6V 5E6W 5E6X 5ES4
DIP:	478
MINT:	129139
STRING:	ENSP00000303242;

Other Databases

GeneCards: ITGB2; Malacards: ITGB2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002523	leukocyte migration invol ved in inflammatory respo nse	IEA	biological_process
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006915	apoptotic process	NAS	biological_process
GO:0006954	inflammatory response	NAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	NAS	biological_process
GO:0007267	cell-cell signaling	NAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008305	integrin complex	NAS	cellular_component
GO:0008360	regulation of cell shape	NAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030101	natural killer cell activ ation	IEA	biological_process
GO:0030141	secretory granule	IEA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030369	ICAM-3 receptor activity	IMP	molecular_function
GO:0030593	neutrophil chemotaxis	IDA	biological_process
GO:0031623	receptor internalization	ISS	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034142	toll-like receptor 4 sign aling pathway	TAS	biological_process
GO:0034687	integrin alphaL-beta2 com plex	IDA	cellular_component
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0043113	receptor clustering	IMP	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043542	endothelial cell migratio n	IEA	biological_process
GO:0045123	cellular extravasation	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0050730	regulation of peptidyl-ty rosine phosphorylation	IDA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050839	cell adhesion molecule bi nding	IMP	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:1903561	extracellular vesicle	IDA	cellular_component
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0002523	leukocyte migration invol ved in inflammatory respo nse	IEA	biological_process
GO:0004872	receptor activity	IEA	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	IEA	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006915	apoptotic process	NAS	biological_process
GO:0006954	inflammatory response	NAS	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	IEA	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IEA	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IEA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	IEA	biological_process
GO:0007229	integrin-mediated signali ng pathway	NAS	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007267	cell-cell signaling	NAS	biological_process
GO:0007568	aging	IEA	biological_process
GO:0008305	integrin complex	IEA	cellular_component
GO:0008305	integrin complex	NAS	cellular_component
GO:0008305	integrin complex	TAS	cellular_component
GO:0008360	regulation of cell shape	NAS	biological_process
GO:0009986	cell surface	IEA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IEA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0016021	integral component of mem brane	IEA	cellular_component
GO:0016337	single organismal cell-ce ll adhesion	IEA	biological_process
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030101	natural killer cell activ ation	IEA	biological_process
GO:0030141	secretory granule	IEA	cellular_component
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030369	ICAM-3 receptor activity	IMP	molecular_function
GO:0030593	neutrophil chemotaxis	IDA	biological_process
GO:0031623	receptor internalization	ISS	biological_process
GO:0032403	protein complex binding	IEA	molecular_function
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034142	toll-like receptor 4 sign aling pathway	TAS	biological_process
GO:0034687	integrin alphaL-beta2 com plex	IDA	cellular_component
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0043113	receptor clustering	IMP	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0043542	endothelial cell migratio n	IEA	biological_process
GO:0045123	cellular extravasation	IEA	biological_process
GO:0045429	positive regulation of ni tric oxide biosynthetic p rocess	IEA	biological_process
GO:0045766	positive regulation of an giogenesis	IEA	biological_process
GO:0046872	metal ion binding	IEA	molecular_function
GO:0046982	protein heterodimerizatio n activity	IEA	molecular_function
GO:0050730	regulation of peptidyl-ty rosine phosphorylation	IDA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050839	cell adhesion molecule bi nding	IEA	molecular_function
GO:0050839	cell adhesion molecule bi nding	IMP	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0051092	positive regulation of NF -kappaB transcription fac tor activity	IEA	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:1903561	extracellular vesicle	IDA	cellular_component
GO:0001948	glycoprotein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005515	protein binding	IPI	molecular_function
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0005886	plasma membrane	TAS	cellular_component
GO:0006915	apoptotic process	NAS	biological_process
GO:0006954	inflammatory response	NAS	biological_process
GO:0007155	cell adhesion	TAS	biological_process
GO:0007159	leukocyte cell-cell adhes ion	IDA	biological_process
GO:0007160	cell-matrix adhesion	IMP	biological_process
GO:0007229	integrin-mediated signali ng pathway	NAS	biological_process
GO:0007229	integrin-mediated signali ng pathway	TAS	biological_process
GO:0007267	cell-cell signaling	NAS	biological_process
GO:0008305	integrin complex	NAS	cellular_component
GO:0008305	integrin complex	TAS	cellular_component
GO:0008360	regulation of cell shape	NAS	biological_process
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0009986	cell surface	IDA	cellular_component
GO:0016020	membrane	IDA	cellular_component
GO:0019901	protein kinase binding	IPI	molecular_function
GO:0030198	extracellular matrix orga nization	TAS	biological_process
GO:0030369	ICAM-3 receptor activity	IMP	molecular_function
GO:0030593	neutrophil chemotaxis	IDA	biological_process
GO:0031623	receptor internalization	ISS	biological_process
GO:0034113	heterotypic cell-cell adh esion	IMP	biological_process
GO:0034142	toll-like receptor 4 sign aling pathway	TAS	biological_process
GO:0034687	integrin alphaL-beta2 com plex	IDA	cellular_component
GO:0035987	endodermal cell different iation	IEP	biological_process
GO:0043113	receptor clustering	IMP	biological_process
GO:0043235	receptor complex	IDA	cellular_component
GO:0050730	regulation of peptidyl-ty rosine phosphorylation	IDA	biological_process
GO:0050776	regulation of immune resp onse	TAS	biological_process
GO:0050839	cell adhesion molecule bi nding	IMP	molecular_function
GO:0050900	leukocyte migration	TAS	biological_process
GO:0070062	extracellular exosome	IDA	cellular_component
GO:0071404	cellular response to low- density lipoprotein parti cle stimulus	ISS	biological_process
GO:1903561	extracellular vesicle	IDA	cellular_component

KEGG pathways

hsa05166  HTLV-I infection
hsa04015  Rap1 signaling pathway
hsa05152  Tuberculosis
hsa04810  Regulation of actin cytoskeleton
hsa04514  Cell adhesion molecules
hsa04390  Hippo signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04145  Phagosome
hsa05323  Rheumatoid arthritis
hsa05146  Amoebiasis
hsa05140  Leishmaniasis
hsa05133  Pertussis
hsa04610  Complement and coagulation cascades
hsa05134  Legionellosis
hsa04670  Leukocyte transendothelial migration
hsa05144  Malaria
hsa05416  Viral myocarditis
hsa05150  Staphylococcus aureus infection

Diseases

Associated diseases	References
Cancer	PMID: 18636124
Chronic kidney failure	PMID: 19578796
Diabetic retinopathy	PMID: 12724690
Endometriosis	PMID: 8595131
Enterocolitis	PMID: 18675632
Glomerulonephritis	PMID: 19420105
Leukocyte adhesion deficiency	KEGG: H00099
Macular degeneration	PMID: 18842294
Metabolic syndrome	PMID: 19056482
Obesity	PMID: 18369341
Parkinson's disease	PMID: 18568448
Endometriosis	INFBASE8595131
Recurrent miscarriage	PMID: 25218545
Restenosis	PMID: 12082592

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
8595131	Endometrio sis					CD18 CD29	Show abstract